KEGG   Erwinia persicina: CI789_16775Help
Entry
CI789_16775       CDS       T05618                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
epe  Erwinia persicina
Pathway
epe00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:epe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CI789_16775
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:epe02000]
    CI789_16775
Enzymes [BR:epe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CI789_16775
Transporters [BR:epe02000]
 Other Transporters
  Pores ion channels [TC:1]
   CI789_16775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 GST_N_4 Tom37
Motif
Other DBs
NCBI-ProteinID: AXU96723
UniProt: A0A354AET2
LinkDB All DBs
Position
complement(3553352..3554014)
Genome map
AA seq 220 aa AA seqDB search
MITVHHLNNSRSQRVLWLLEELEVPYQIKRYQREGTLLAPPELKKVHPLGKAPVITDDNR
VVAESGAILEYLEAHYDIGGQLKPIDDEAVIQSRYWLHYAEGSLMPLLVMKLIFSRMGKA
PVPWLLRPIGSAFGKGVQKGYLDPQLATHRQFIEQHLARNEWFAGSRFSIADVQMSFPLQ
ALTARGGAADSPAIQAWLQKVESRAAWQRALQQGGEVKFD
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccgtacatcacctgaataactcacgctcacagcgcgtgctgtggctgctggaa
gagctggaagtcccgtatcagattaaacgttatcagcgggagggtacgctgctggccccc
ccggagctgaaaaaagtgcacccgttaggtaaagccccggtgatcaccgatgacaatcgc
gtggtggcggagtcaggggcgattctggaatatctggaagcgcactatgatatcggtggc
cagttgaagccaatcgatgacgaagcggtgatccagtcgcgctactggctgcactatgcg
gaagggtccctgatgccgctgctggtgatgaagctgattttcagccgcatggggaaagcc
ccggttccctggctgctgcggccgatcggcagcgcctttggtaaaggggtgcagaagggc
taccttgacccacagctcgccacccaccgtcagtttattgagcagcatctggcccgcaac
gaatggtttgccggtagccggttcagcatcgctgacgtccagatgagcttccccctgcag
gccctgaccgcgcgcggtggggccgccgacagtccggctatccaggcctggctgcagaag
gtagagagccgtgccgcctggcagcgtgcgctgcagcagggcggtgaagtgaagtttgat
tga

DBGET integrated database retrieval system