KEGG   Erwinia persicina: CI789_23540Help
Entry
CI789_23540       CDS       T05618                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
epe  Erwinia persicina
Pathway
epe00730  Thiamine metabolism
epe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:epe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CI789_23540
Enzymes [BR:epe01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     CI789_23540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 Pyr_redox_2 NAD_binding_8 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AXU98178
UniProt: A0A3Q8H8N5
LinkDB All DBs
Position
pEP2:40676..41608
Genome map
AA seq 310 aa AA seqDB search
MSRWSVIGDGVAGLCIATILAEHGQAVEVITSPQHDAASHWAGGMLAPWCEGESAPAEVV
ELGQRSAPWWAARVKGVEHQGTLVVAPPRDAPELTRFSRMTHAHQWVEPVTLEPALEGRF
ARGLFFAGEAHLDPRSALQQLRASLLQHGVDFHQDKPGGTVIDCRGIHAAHEQPGLRAVR
GEMLILHSDEVHFSRPVRLLHPRFPCYLVPRTGGRFMLGATMVESHDDSPISARAMMELL
SAAYAIHPALAEARVLESGTGLRPAYADNVPAIHRHNGVWSVNGMYRHGFLLAPVMAENL
MQQLIQENLI
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagccgctggtctgtgatcggtgacggcgtggccgggctgtgcatcgccacgatactg
gcagagcacggccaggccgtggaggtgatcacttcaccgcagcatgatgcggcatcccac
tgggcaggcggaatgctggccccctggtgcgaaggcgaaagcgccccggcggaggttgtt
gagctgggccagcggtctgccccgtggtgggctgcgcgtgtcaaaggcgtggagcatcag
ggcaccctggtggtcgctcccccgcgcgacgcgcctgaactcacccgtttttcgcgcatg
acgcacgcccatcagtgggtggaaccggtcacgctggaacccgccctggaagggcgcttt
gcccgcgggctgttctttgccggcgaggcccatctcgacccgcgcagcgcgctgcagcag
ctgcgggccagcctgcttcaacacggcgttgacttccatcaggacaagcccggcggcacg
gttattgactgccgggggatccacgctgcccacgaacaaccgggactgcgcgccgttcgc
ggtgaaatgctgatcctgcacagcgatgaggtgcacttctcccggcccgtccgcttgctc
catccccgctttccctgttacctcgttccgcgcacgggggggcgctttatgctgggggcg
accatggtggaaagccatgatgacagccccattagcgcccgcgccatgatggagctgtta
agtgccgcttacgccatccacccggcactggccgaagccagagtgctggaaagcggcacc
gggctgcgaccggcttacgctgataatgtccctgccattcatcgccataacggcgtctgg
tccgttaacggcatgtaccggcacggctttcttctcgcgccagtgatggcggaaaacctg
atgcagcaactgatacaggaaaacctgatatga

DBGET integrated database retrieval system