KEGG   Endomicrobium proavitum: Epro_0138Help
Entry
Epro_0138         CDS       T03965                                 

Gene name
glgP
Definition
(GenBank) Alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
epo  Endomicrobium proavitum
Pathway
epo00500  Starch and sucrose metabolism
epo01100  Metabolic pathways
epo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:epo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Epro_0138 (glgP)
Enzymes [BR:epo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Epro_0138 (glgP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417
Motif
Other DBs
NCBI-ProteinID: AKL97517
UniProt: A0A0G3WI26
LinkDB All DBs
Position
171649..174252
Genome map
AA seq 867 aa AA seqDB search
MNKDLFNENQETFVSPNAKAFVVVPNLPEILSPLLAIANNVWWCWNSDAVELFRRLDRDL
WEETYHNPKAMLGMIKQETLAALSEDDSFVSHMERVKGELDKYMSMNTWYHDSCSDYADM
KFAYFSTEFAIHESLPIYSGGLGILSGDHLKSASDMGLPLVGVGLLYRYGYFKQYLNSDG
IQQEEYNENHFELMPLELVKDKKNEPLIITIDIPKEKISARVWKLQVGRVPLYLLDTDFS
KNSKEVREITGELYGGDRNMRIRQEILLGVGGVKLLKALNIDPGVIHINEGHSAFLLLEK
MREYIEDEGLSQAEAFQLVQSGCVFTTHTPVPAGNEIFGADLVTRYFEPMYKKLGFSAEQ
FLALGSFPAKNLKMGNPSDFSMTILALKMTNKANGVSRLHATVAREMWSGIWPGLPRKEI
PITHITNGIHTNTWISYEFAGLFDRYLGAAWKDEPADHTIWQRVAHIPDAELWRSHERRR
ERLVSFARARLKHQLKRRGLSEIMSSYADEVLDPEALTIGFARRFASYKRGNLIFKDLER
IKKIITSKEHPVQIIIAGKAHPQDGVGKEIIKQIVSLANDPELKYKVVFLEDYDMNVAHY
LVQGADIWLNNPLRPEEASGTSGMKAAVNGALNFSVLDGWWCEGYNGDNGWTIGSIDEYS
DREYQDEVESKAIYDTLEKEIVPLFYARGIDGIPRGWTKKMKMSMQTLGPVFNTNRMIEE
YAKKFYITSALSHEKLKKNKFEAAKKKAQWLINVRNNWKDVHVVKVEDNINGEISVFGDM
SVTARVYIGSLNPEDVSVQIFSGFINSKQVVSSQETYEMRLVSKEGNDFIFEGKVFADKV
GRCGYTVRILPQCGGEVQYISELIKWQ
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagatttatttaacgaaaatcaggaaacttttgtttctccaaacgctaaagct
tttgtagttgtgcctaatcttccggaaattctttctccgcttcttgccatagcaaataac
gtttggtggtgctggaactccgacgccgtagaacttttcagaagacttgacagagatttg
tgggaagaaacttatcataatcctaaagctatgcttggcatgataaaacaggaaactctc
gccgcgctttccgaagacgacagttttgtgtctcacatggaaagagtaaaaggcgaactt
gataaatatatgtccatgaatacttggtatcacgattcgtgttcggattacgccgatatg
aaatttgcgtatttctccacggagtttgcaatacatgaaagccttccgatttattccggc
gggcttggaattttatcgggcgaccacttaaaatccgcaagcgatatgggtttgccgctt
gtgggcgtaggacttctttacagatacggatattttaaacagtatttaaattccgacgga
atacagcaggaagagtataacgaaaatcattttgagcttatgcctcttgagcttgttaaa
gataaaaagaacgaaccgcttataataaccatagatattcctaaagaaaaaatttccgcg
cgggtttggaagcttcaagtcggaagagttcctctgtatcttttggataccgatttcagt
aaaaattcaaaagaggtaagagagataaccggcgagctttacggcggcgatagaaatatg
cgcattcgtcaagaaattttgcttggcgtgggcggagtaaaacttcttaaagctttaaat
atagacccgggcgtaatacatattaacgaaggtcattcggcttttttgcttcttgaaaaa
atgagggagtacatagaagacgaagggctttctcaggcagaagcgttccagcttgtgcaa
agcggatgcgtgtttacaacgcacacgcctgttccggcgggaaatgaaattttcggcgcg
gatcttgttacaagatattttgaaccgatgtataaaaaactgggtttttccgcagaacaa
tttttagcgctcggatcgtttccggcaaaaaatttgaagatgggaaatccttcggatttt
tctatgaccattcttgctttgaaaatgacaaacaaagcaaacggcgtcagcagacttcac
gctaccgttgcaagagaaatgtggtcgggcatatggccgggtttgcccagaaaagaaatt
ccgataacgcacataacaaacggcatacatacaaatacgtggatatcttacgagtttgcc
ggactttttgacagatatctcggcgcggcgtggaaagacgagccggcggatcatacaata
tggcagagagtggctcatattcccgatgcggaactttggagaagtcatgaaagaagaaga
gaaaggcttgtgtcttttgccagagcgcgccttaaacaccagcttaagcgcagaggtctt
tccgaaattatgtcaagttacgccgacgaagttttagatccggaagcgctcacaataggt
tttgcgagaagatttgcttcctataaacgcggcaatttaatttttaaagatttggaaaga
attaaaaaaattattaccagcaaggaacaccccgtccaaattattatcgccggaaaagcg
catccgcaagacggcgttggaaaagaaataataaaacagatagtaagccttgcaaacgat
cccgaacttaaatataaagtagtgtttttggaagattacgatatgaatgtggcgcactat
cttgtgcagggcgccgacatatggcttaataatcctctgcgtccggaagaagcgtcggga
acgagcggtatgaaagccgcggttaacggagctttaaatttcagcgttttagacggctgg
tggtgcgaaggatataacggtgacaacggttggactataggttctatagacgaatattcc
gacagagagtatcaggacgaagttgaaagcaaagccatttacgacactcttgaaaaagaa
attgttccgctgttttacgccagaggcatagacggcattccaagaggctggacaaagaaa
atgaaaatgtccatgcaaacgctcggacccgttttcaacacaaacagaatgattgaagag
tatgctaaaaagttttatataacttcggcgctttcgcatgaaaaattgaaaaaaaataaa
tttgaagcggctaaaaagaaagcccagtggcttataaacgtgcgcaacaactggaaagac
gttcacgtcgtaaaagttgaagataacataaacggcgaaataagcgttttcggcgatatg
tctgttacagcgagggtttatataggctctttaaatcctgaagacgtcagcgttcaaatt
ttcagcggttttataaattcaaagcaagttgtaagctctcaagaaacttatgaaatgagg
cttgtttcaaaagaaggcaacgattttatttttgaagggaaggtttttgccgacaaagtc
ggacgctgcggatataccgttagaattcttccgcaatgcggcggagaagtgcagtatata
tccgaacttataaaatggcaatga

DBGET integrated database retrieval system