KEGG   Erwinia pyrifoliae DSM 12163: EPYR_02521Help
Entry
EPYR_02521        CDS       T02121                                 

Gene name
hlyD
Definition
(GenBank) HlyD family secretion protein
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
epr  Erwinia pyrifoliae DSM 12163
Brite
KEGG Orthology (KO) [BR:epr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:epr02000]
    EPYR_02521 (hlyD)
Transporters [BR:epr02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   EPYR_02521 (hlyD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 Biotin_lipoyl_2 HlyD_3 HlyD Biotin_lipoyl DUF4407
Motif
Other DBs
NCBI-ProteinID: CAY74901
UniProt: D2TDY4
LinkDB All DBs
Position
complement(2591921..2593153)
Genome map
AA seq 410 aa AA seqDB search
MSGTPGICQFCSYVYIRLNNCVSALATPALMDTMAKQTSSSPDDESLPQHESQPADDGQE
DDKNRPRPGKKPLIILAIVAVVMLSVALVFWLMNRNIETTDDAFTEADAVTIAPKASGYI
TQLKVKDNQRVKKGDLLVVIDVRDASAQRDRAQAELGVAVAQLHQAQAQLALARVQYPAQ
KEQALAQLARAEANYLNAREDDKRQRGVDPRATSQRNIDAASAQLRSAKAELKNAQAQVA
VASQVALQIRQQETSVEARQSQVDQGQAQLNTASLNLSYTEVRAPYDGFITKRNVQVGTL
VQAGSSLFSLVSPDMWIVANFKESQLARMKPGNKVDISVDAWPDLKLKGHVDSVQMGSGS
RFSAFPSENATGNYVKIVQRVPVKIVIDSGLDANHPLPIGLSVEPKVTLE
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaggaactcctggcatttgtcaattctgctcctatgtttatatcaggctgaataat
tgcgtctccgctttggcgacgcccgcattgatggatactatggctaagcaaacctcctcc
tcacctgatgatgaatccttgccgcaacatgaatcacaaccggccgacgacggtcaggaa
gatgataaaaatcgtccacgacccggtaaaaagccgctgattatcctggcaattgtagct
gttgtgatgctatcggttgcgctggttttctggttgatgaaccgcaatattgaaaccacc
gacgatgcttttaccgaagcggatgcggtgaccatcgcacccaaagcgtcggggtatatc
acccagttgaaagtcaaagataaccagcgggtgaagaaaggggatctgctggtggtgatt
gatgtgcgtgatgccagcgcgcagcgcgatcgggcgcaggcggagcttggggttgccgtg
gcacagttacatcaggctcaggcgcagctggctctggcacgggtacagtatccggcgcag
aaagagcaggcgttggcgcagctggcgcgtgctgaagccaactatctcaacgcgcgggaa
gatgataaacgtcagcgcggcgttgacccgcgtgcaacttcgcaacgtaatatcgatgct
gccagcgcccagttacgcagtgctaaagcggagctgaaaaatgcgcaggctcaggttgcc
gtagcctcgcaggtcgctttacagatccgtcagcaggaaaccagcgtcgaagcgcgtcag
agccaggtcgatcaggggcaggcgcagctcaataccgccagccttaacctgtcctacacc
gaggtgcgcgcgccttacgatggctttatcaccaaacgcaatgtgcaggtgggcacgctg
gtgcaggcgggttcttcgctgttttctctggtatcaccggatatgtggattgtagcgaac
tttaaagaatcccagctggcgcgcatgaagccgggtaataaggtcgatatcagcgtcgat
gcctggcccgatctgaagctgaaagggcatgtcgacagcgtgcagatgggcagcggttca
cgtttctcggccttcccgtctgaaaatgccaccggaaactatgtgaaaattgtccagcgt
gttccggtgaagattgtcattgatagcgggttggatgccaaccatccgctgccgattggc
ctgtcggttgaaccgaaggtgacgctggaatga

DBGET integrated database retrieval system