KEGG   Erwinia pyrifoliae DSM 12163: EPYR_03680Help
Entry
EPYR_03680        CDS       T02121                                 

Gene name
mrcA
Definition
(GenBank) penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
epr00550  Peptidoglycan biosynthesis
epr01100  Metabolic pathways
epr01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:epr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EPYR_03680 (mrcA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    EPYR_03680 (mrcA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:epr01003]
    EPYR_03680 (mrcA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:epr01011]
    EPYR_03680 (mrcA)
Enzymes [BR:epr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     EPYR_03680 (mrcA)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     EPYR_03680 (mrcA)
Glycosyltransferases [BR:epr01003]
 Polysaccharide
  Bacterial polysaccharide
   EPYR_03680 (mrcA)
Peptidoglycan biosynthesis and degradation proteins [BR:epr01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   EPYR_03680 (mrcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase
Motif
Other DBs
NCBI-ProteinID: CAY76060
UniProt: D2T9A9
LinkDB All DBs
Position
3724283..3726829
Genome map
AA seq 848 aa AA seqDB search
MKFVKYLLILAVCCILLGAASIYGLYKYIEPQLPDVATLKDVRLQTPMQVYSADNELIAQ
YGEKRRIPLTLQEIPPQMVKAFIATEDSRFYEHHGVDPIGIFRAASIALTSGHASQGAST
ITQQLARNFFLSPERTLMRKIKEAFLAVRIEQTMSKDEILELYLNKIYLGYRAYGVGAAA
QVYFGKNVDQLSLSEIAMIAGLPKAPSTFNPLYSHDRAVARRNTVLARMLNQQYITQAQY
NEARITPLVANYHAPEIAFSAPWLTEMVRQEMIKRYGENAYTDGYKVYTTVTRKLQLAGQ
AAVQDNVIAYDMRHGYRGPGGLLWKTGELAWDHAQILNVLKSLPVYGPLFPAVVTASHND
EADATMRDGSNVTLNLASVRWARPYKSDTLQGATPRSVSQVLQPGQQIWLRKVDNDWQLA
QVPDVNSSLVSLDPHNGAVRALVGGFDFNLSKFNRATQSLRQVGSNIKPFLYTAAMDRGL
TLASILNDMPISRWDAGAGADWRPKNSPNTYSGPIRLRQGLGESKNVVMVRAMRAMGVDY
AAEYLQRFGFPAQNIVHTESLALGSASFTPLQMVRGYSVMANGGFLVDPWFIARIEDEMG
NKLFEARPKVACPECNLPVVYGETQKAVALSEDSIESVAVSQEGHNAAMPQPQLAQVPEQ
QDGAQQYAPHVINTPLSFLIKSALNSNIFGEPGWMGTGWRAGRDLKRNDIGGKTGTTNSS
KDAWFSGYGPGVATSVWIGFDDHRRDLGRTTASGAIKDQISGYEGGAKSAQPAWDDYMKS
ALDGVPLQPLTPPEGIVTVKIDRGTGKLANGGGNTRDEYFINGTQPTEYSVHDVGTTLLD
NGESHELF
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttcgtaaagtatttattgatccttgcagtgtgttgcatcttgctgggagccgcc
tcgatttatggtctgtacaaatacatagagccgcagctacctgatgtcgctacgctgaaa
gatgtgcgtttgcaaacgccaatgcaggtctacagtgccgataacgagcttatcgcgcag
tacggtgaaaagcgccgtattccgctgaccctgcaagagatcccgccgcagatggtgaaa
gcctttatcgcgacggaagacagccgtttctacgagcaccacggcgtcgacccgattggc
attttccgtgccgccagcattgcgctgacatccggccatgcctcgcagggtgccagtacc
attactcaacagctggcacgtaactttttccttagccctgaacgcacgctgatgcgtaag
atcaaggaagcctttctcgccgttcgtattgagcagacgatgagcaaggatgagatcctt
gaactgtatctgaataagatctatctcggctatcgcgcatacggcgtgggagccgcagcc
caggtttacttcggcaagaatgttgaccagctttcgctcagtgaaatagcgatgatcgcc
ggcctgccaaaagcaccttcaacgtttaacccgctgtattcgcacgaccgtgcggtagcg
cgccgtaatacggtactggcacgtatgctcaaccagcagtacatcacccaggcgcagtac
aatgaagcacgtattacaccgctggttgccaactaccacgcgcctgaaatcgctttctca
gcgccgtggctgaccgagatggtgcgccaggagatgatcaagcgttacggcgaaaatgcc
tataccgatggctacaaggtctacaccaccgtgacgcgcaagctacaactggccgggcag
gctgcggtgcaggacaacgtgattgcctatgatatgcgtcacggctatcgcgggccgggt
ggcctgctgtggaaaacgggcgagctggcctgggatcacgcccaaatcctcaacgtcctg
aaatccctgccggtttacggcccgctgttcccagccgtggtcactgccagtcacaacgat
gaagccgatgcgacgatgcgcgacggcagcaacgtgacgttaaatcttgccagcgtgcgc
tgggcgcgcccgtacaagtcagacaccttacaaggtgctacgccgcgctctgtcagccag
gtattacagcccggccagcagatctggctacgtaaagtcgataacgactggcagctggca
caggtgcctgacgtcaattcctcgctggtttcgctcgatccacataatggtgcggtgcgc
gccctggtcggcggttttgacttcaacctgagcaaatttaaccgtgcaacgcagtcgttg
cgtcaggtcggctcgaatattaaaccgttcctgtacaccgccgccatggatcgcggcctg
acgcttgcctccattcttaacgatatgccgatttcccgttgggatgccggagccggtgct
gactggcggccgaaaaactctccgaatacttattccggccccatccgcctgcggcagggg
ctgggtgagtcgaaaaacgtggtaatggtgcgtgcgatgcgggcgatgggcgtcgactac
gctgccgaatatctgcaacgcttcggcttcccggcacagaatattgtgcataccgaatca
ctggcgctgggttctgcttcctttacgccattacagatggtgcgcggctactcggtgatg
gcgaatggcggctttctggtcgatccatggtttattgcccgtatcgaagatgagatggga
aataagctgttcgaggcccggccgaaagtagcctgcccggagtgcaatttgccggttgtc
tacggggaaacgcaaaaagccgtcgccctgagtgaagacagcattgaaagcgtggcggta
tctcaggaaggtcataacgcggcgatgccacagccccagctggcacaggtgccggagcag
caggacggtgcgcaacagtatgcgccacacgttatcaacacgccgctgtctttcctgatc
aaaagcgcattgaactccaacatctttggtgaacctggctggatgggaaccggctggcgt
gccgggcgtgacctgaagcgcaatgatattggtggtaaaaccggcaccacgaacagctcg
aaagatgcctggttctccggttacggaccaggagtggcgacatccgtgtggatcggcttc
gacgaccatcgtcgtgacctggggcgcaccacggcatccggtgccatcaaagatcagatc
tctggctacgagggcggtgctaaaagtgctcagcccgcgtgggatgattatatgaagtca
gcgctggatggcgtaccgcttcagccgctgacgccaccagagggaatagtaacggtcaaa
atagatcgcggcaccggtaagctggccaacggcggcggcaacacgcgtgatgaatacttt
atcaacggcacccagccgacagagtattcggtgcatgatgtcggtaccacgctgctggat
aacggcgagagccacgagctgttctag

DBGET integrated database retrieval system