KEGG   Erwinia pyrifoliae Ep1/96: EpC_04140Help
Entry
EpC_04140         CDS       T01000                                 

Gene name
ampH
Definition
(GenBank) Penicillin-binding protein
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
epy  Erwinia pyrifoliae Ep1/96
Brite
KEGG Orthology (KO) [BR:epy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:epy01002]
    EpC_04140 (ampH)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:epy01011]
    EpC_04140 (ampH)
Enzymes [BR:epy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     EpC_04140 (ampH)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     EpC_04140 (ampH)
Peptidases [BR:epy01002]
 Serine Peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   EpC_04140 (ampH)
Peptidoglycan biosynthesis and degradation proteins [BR:epy01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   EpC_04140 (ampH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: CAX54172
LinkDB All DBs
Position
complement(492622..493797)
Genome map
AA seq 391 aa AA seqDB search
MKPSLCAFLLLPVLALPLAGQARTAPDPLLAAKTVERYADNIFYNTKASAMAIVAIDANQ
RVFASRGSVRPGSQQPPEKDSLIRVASLSKLMTSQLMVRLAEEGRLQLDDPLSKYAPPGS
RVPSFNGQPIRLINLATHTSALPREQPGGKAVRAVFTWPTYSQRWNWLGTAKLKWTPGER
AAYSNLAFDLLGDALAKAGGKPYSALFREKITRPLGMKDTTFTPSPDQCGRLIVPAKNPS
PCDNSLAAIGSGGVYSTPEDMGRWMQQFLSSGMHTRSPQADSLQTMIYRRGQLSKVEGMD
VPGRADALGMGWVYMAPREGRPGIIEKTGGGGGFITYMAMVPQYSVGVFVVVARTAETRF
TPMSDGANNLLTELIGNTSGSAQLAASIMAN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaccctcgctctgtgcttttttgctgcttcccgtgctggcactgccgttggcaggc
caggcgcgaaccgctcccgacccgctgctggcagcaaagacggttgaacgctacgctgat
aacatcttttacaacaccaaagccagcgcaatggcgatagtcgctattgatgccaatcag
cgggtgtttgccagccgtggttcggtacgccctggtagtcagcagccaccagaaaaagat
tcactgatacgcgtggcatcactgagcaagctgatgaccagccagctcatggtcaggctg
gccgaagagggtcgtttgcagctggacgacccactcagcaaatatgcccctcccggcagc
agggtgcccagctttaacgggcaaccgatccgcctgatcaacctcgctacccataccagc
gccctgccacgggagcagcccggcggtaaggcggtgcgtgccgtgtttacctggcccacc
tacagtcaacgctggaactggctcggcaccgcgaagctgaagtggacgcccggcgaacga
gccgcttactctaacctcgcctttgacctgctgggtgatgcgctggcaaaggctggcggc
aagccttattctgcactgtttcgcgagaagatcacccgtccattggggatgaaggacacc
acctttaccccctcacccgatcagtgtggccgtctgatcgtcccggccaaaaatcccagc
ccctgtgataattctctggcggccatcggcagcggcggcgtttactccaccccggaggat
atggggcgctggatgcagcaattcctttcatctggcatgcatacccgcagcccacaggcc
gatagcttgcaaacgatgatttatcgacgcggtcagttgagtaaagtggaaggtatggat
gtacctggccgggcagatgcgctggggatgggttgggtatatatggctccgcgcgaaggg
cgtccgggcattattgaaaaaaccggcggcggcggcgggtttattacctatatggcgatg
gtgccgcagtacagcgtgggcgtgtttgttgtggtagcccggacggcagaaacccgcttt
acgccaatgagcgatggggcaaataatctgctgaccgagctgatcggtaatacctccggc
agcgctcagttagccgccagcattatggctaactaa

DBGET integrated database retrieval system