KEGG   Erwinia pyrifoliae Ep1/96: EpC_10850Help
Entry
EpC_10850         CDS       T01000                                 

Definition
(GenBank) Phosphate import ATP-binding protein (ABC phosphate transporter)
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
epy02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:epy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    EpC_10850
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:epy02000]
    EpC_10850
Enzymes [BR:epy01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     EpC_10850
Transporters [BR:epy02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    EpC_10850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_16 AAA_22 RsgA_GTPase AAA_23 AAA_29 AAA_33 AAA_15 Rad17 AAA_24 AAA_30 AAA_5 AAA_25 TniB AAA_28 ATPase_2
Motif
Other DBs
NCBI-ProteinID: CAX54864
LinkDB All DBs
Position
1247313..1248089
Genome map
AA seq 258 aa AA seqDB search
MAITLNDVNTALELDNLNLWYGEKQALNNISLQLPANRITALIGPSGCGKSTLLRCFNRM
NDAIDGCRISGDIRLQQHSILASGQDLCALRRRVGMVFQRPNPFAKSIYDNVVYGLRLQG
VRDKRVLDEAAERALRAAALWAEVKDNLWQNALTLSSGQQQRLVIARAIAIESEILLLDE
PTSALDPIATLVIEELMTTLKQHFTLILVTHNMQQAARVSDYTAFMHQGRVVEFGLTDTL
FTAPRQRRTEDYITGRYG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcaccttaaatgatgtgaataccgcgctggaactggacaacctgaacttatgg
tatggcgaaaaacaggcattaaacaacatcagcctgcagttgcctgcaaaccgcatcacc
gcactgatcggcccttccggctgcggtaagtcgacgctgttacgctgcttcaaccgcatg
aacgatgccatcgacggctgccgcattagcggggatatccgtctgcagcagcactccatt
ctggcgtccgggcaggatctctgcgcgctgcgccgccgggttggcatggtgtttcagcgg
ccaaatccctttgccaagtccatctatgacaacgtggtgtacggcctccgtttacagggc
gtgcgtgacaagcgcgtgctggatgaagcagccgagcgggcgctgcgggctgcggcgcta
tgggcagaggtgaaagacaatttgtggcagaacgccctgacgctctccagcgggcagcag
cagcggctggttatagcccgcgctatcgccatagagtcggaaatcctgctgctggatgag
ccaacgtcggcgcttgacccgattgccacgctggtaattgaagaattgatgaccacgctg
aaacagcatttcaccctgatcctggtcacgcacaatatgcagcaggcggcgcgcgtatct
gactataccgcgtttatgcaccagggccgggtagtggaatttggtctgaccgatacgctg
tttaccgcaccacgccagcgccgtacggaggattatattaccggaaggtatggctga

DBGET integrated database retrieval system