KEGG   Erwinia pyrifoliae Ep1/96: EpC_23310Help
Entry
EpC_23310         CDS       T01000                                 

Gene name
emrK
Definition
(GenBank) Putative multidrug resistance protein K
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
epy  Erwinia pyrifoliae Ep1/96
Brite
KEGG Orthology (KO) [BR:epy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:epy02000]
    EpC_23310 (emrK)
Transporters [BR:epy02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   EpC_23310 (emrK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 Biotin_lipoyl_2 HlyD_3 HlyD Biotin_lipoyl DUF4407 HlyD_2
Motif
Other DBs
NCBI-ProteinID: CAX56110
LinkDB All DBs
Position
complement(2591863..2593005)
Genome map
AA seq 380 aa AA seqDB search
MDTMAKQTSSSPDDESLPQHESQPADDGQEDDKNRPRPGKKPLIILAIVAVVMLSVALVF
WLMNRNIETTDDAFTEADAVTIAPKASGYITQLKVKDNQRVKKGDLLVVIDVRDASAQRD
RAQAELGVAVAQLHQAQAQLALARVQYPAQKEQALAQLARAEANYLNAREDDKRQRGVDP
RATSQRNIDAASAQLRSAKAELKNAQAQVAVASQVALQIRQQETSVEARQSQVDQGQAQL
NTASLNLSYTEVRAPYDGFITKRNVQVGTLVQAGSSLFSLVSPDMWIVANFKESQLARMK
PGNKVDISVDAWPDLKLKGHVDSVQMGSGSRFSAFPSENATGNYVKIVQRVPVKIVIDSG
LDANHPLPIGLSVEPKVTLE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggatactatggctaagcaaacctcctcctcacctgatgatgaatccttgccgcaacat
gaatcacaaccggccgacgacggtcaggaagatgataaaaatcgtccacgacccggtaaa
aagccgctgattatcctggcaattgtagctgttgtgatgctatcggttgcgctggttttc
tggttgatgaaccgcaatattgaaaccaccgacgatgcttttaccgaagcggatgcggtg
accatcgcacccaaagcgtcggggtatatcacccagttgaaagtcaaagataaccagcgg
gtgaagaaaggggatctgctggtggtgattgatgtgcgtgatgccagcgcgcagcgcgat
cgggcgcaggcggagcttggggttgccgtggcacagttacatcaggctcaggcgcagctg
gctctggcacgggtacagtatccggcgcagaaagagcaggcgttggcgcagctggcgcgt
gctgaagccaactatctcaacgcgcgggaagatgataaacgtcagcgcggcgttgacccg
cgtgcaacttcgcaacgtaatatcgatgctgccagcgcccagttacgcagtgctaaagcg
gagctgaaaaatgcgcaggctcaggttgccgtagcctcgcaggtcgctttacagatccgt
cagcaggaaaccagcgtcgaagcgcgtcagagccaggtcgatcaggggcaggcgcagctc
aataccgccagccttaacctgtcctacaccgaggtgcgcgcgccttacgatggctttatc
accaaacgcaatgtgcaggtgggcacgctggtgcaggcgggttcttcgctgttttctctg
gtatcaccggatatgtggattgtagcgaactttaaagaatcccagctggcgcgcatgaag
ccgggtaataaggtcgatatcagcgtcgatgcctggcccgatctgaagctgaaagggcat
gtcgacagcgtgcagatgggcagcggttcacgtttctcggccttcccgtctgaaaatgcc
accggaaactatgtgaaaattgtccagcgtgttccggtgaagattgtcattgatagcggg
ttggatgccaaccatccgctgccgattggcctgtcggttgaaccgaaggtgacgctggaa
tga

DBGET integrated database retrieval system