KEGG   Erwinia pyrifoliae Ep1/96: EpC_24170Help
Entry
EpC_24170         CDS       T01000                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
epy00010  Glycolysis / Gluconeogenesis
epy00260  Glycine, serine and threonine metabolism
epy00680  Methane metabolism
epy01100  Metabolic pathways
epy01110  Biosynthesis of secondary metabolites
epy01120  Microbial metabolism in diverse environments
epy01130  Biosynthesis of antibiotics
epy01200  Carbon metabolism
epy01230  Biosynthesis of amino acids
Module
epy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
epy_M00002  Glycolysis, core module involving three-carbon compounds
epy_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:epy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EpC_24170 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    EpC_24170 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EpC_24170 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:epy04131]
    EpC_24170 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:epy04147]
    EpC_24170 (gpmA)
Enzymes [BR:epy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EpC_24170 (gpmA)
Membrane trafficking [BR:epy04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    EpC_24170 (gpmA)
Exosome [BR:epy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EpC_24170 (gpmA)
  Exosomal proteins of melanoma cells
   EpC_24170 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAX56196
LinkDB All DBs
Position
2678161..2678913
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGRTEAKAAGQLLKKEGFTFDFAYTSVL
KRAIHTLWNILDEVDQVWLPVEKSWRLNERHYGALQGLDKAETANKYGDEQVKQWRRGFA
VTPPELDRADERFPGHDPRYASLSAEQLPTTESLALTIDRVLPYWNESILPRMKSGEKVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPIRHYYLGDADEIAAKA
ADVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaacaaagctggttctggtacgtcacggcgaaagccagtggaacaacgaaaac
cgtttcaccggttggtacgacgttgatctgtcagagaaaggccgcaccgaggcaaaagcc
gccggtcagctgctgaagaaagaaggttttaccttcgattttgcttacacttctgtgctg
aaacgtgccattcataccttgtggaacatcctggatgaagttgaccaggtgtggctgccg
gtagagaagtcatggcgtcttaacgagcgtcactacggtgcgctgcaaggactggataag
gctgaaaccgctaacaaatacggtgacgagcaggttaagcagtggcgtcgtggctttgcc
gttaccccacctgagctggatcgtgccgatgagcgtttccccggtcacgatcctcgctat
gcttcgttgtccgctgaacagttgccgacgaccgaaagcctggcgctgaccattgaccgc
gtgctgccatactggaatgaatctattctgccgcgtatgaaaagcggagagaaagtgatc
attgccgcgcacggtaactccttgcgcgcgctggtcaaatacctggacaatatgagtgaa
gaagagatcctcgaattaaatatcccgactggcgtaccgctggtctatgagttcgatgaa
aactttaagccgatcagacactactacctgggcgatgcagatgaaatcgccgctaaggca
gctgacgtagctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system