KEGG   Erwinia pyrifoliae Ep1/96: EpC_32810Help
Entry
EpC_32810         CDS       T01000                                 

Definition
(GenBank) Putative glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
epy00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:epy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EpC_32810
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:epy02000]
    EpC_32810
Enzymes [BR:epy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     EpC_32810
Transporters [BR:epy02000]
 Other Transporters
  Pores ion channels [TC:1]
   EpC_32810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_N_4 GST_C_2 GST_C_3 Tom37
Motif
Other DBs
NCBI-ProteinID: CAX57060
LinkDB All DBs
Position
complement(3580921..3581583)
Genome map
AA seq 220 aa AA seqDB search
MITVHHLNNSRSQRVLWLLEELEVPYQIKRYQRGASMLAPDELKKVHPLGKSPVITDGNR
VVAESGAILEYLEAHYDAEERLKLFDDEEVIQSRYWLHYAEGSLMPLLVMKLIFSRMGKA
PVPWLLRPIGSAFGKGVQKGYIDPQLATHRQFIEQHLTSNEWFAGSRFSIADVQMSFPIQ
AITARGGAAGSPAIQAWLEKVQCRAAWQRALDKGGKINLV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgatcactgtgcaccatcttaacaattcacgttcgcagcgcgtgctgtggctgctggaa
gagcttgaagtgccgtatcagatcaagcgctatcagcgtggagccagcatgctggctcct
gacgagctaaaaaaagtgcacccgctgggcaaatccccggtgattaccgatggaaatcgt
gttgtggcggaatccggcgcgatcctggagtacctggaggcgcattatgacgccgaagag
cggctgaaactttttgacgatgaagaggtaatacaatctcgttattggttgcactatgcc
gaaggttcattaatgccgttgctggtgatgaaactgatctttagccgtatgggtaaagcg
ccggtaccctggctgttgcgaccgattggcagtgcgtttggtaaaggcgtgcagaagggc
tatatcgacccacaactggccactcatcgccagtttatcgagcagcacctgaccagcaat
gagtggtttgccggtagtcgattcagcattgccgatgtacagatgagctttccgatacag
gcgatcaccgcgcgtggtggtgccgctggcagcccggcgattcaggcctggctggaaaaa
gtgcagtgccgcgcggcctggcagcgcgcgctggataaagggggcaaaattaaccttgtg
tga

DBGET integrated database retrieval system