KEGG   Erwinia pyrifoliae Ep1/96: EpC_34430Help
Entry
EpC_34430         CDS       T01000                                 

Gene name
glpD
Definition
(GenBank) Sn-glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
epy00564  Glycerophospholipid metabolism
epy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:epy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EpC_34430 (glpD)
Enzymes [BR:epy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     EpC_34430 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 Pyr_redox_2 3HCDH_N GIDA Lycopene_cycl FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: CAX57222
LinkDB All DBs
Position
3755586..3757091
Genome map
AA seq 501 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVGEALAEREVLLKMAPHIAFPMRFLLPHRPHLRPAWMIRMGLFMYDHLGKRTSLPGS
KSVLFGSDSILKPEIVRGFEYSDCWVDDARLVVLNAQEVEKRGGTVRTRTRVTRARRENG
LWIVEAEDIDSGKIFTWRAKGLVNAAGPWVKQLFDDGLKLKSPYGIRLIKGSHIVVPRIG
SQKQAYILQNEDNRIVFVIPWMDEFSIIGTTDVEYKGDAHNVKIDDNEIDYLLKVFNAHF
KQDLSRDDIVWSYSGVRPLCDDESDSPQAITRDYTLDVHDDGGQAPLLSVFGGKLTTYRK
LAEHAMEKLSKYYPHAGAAWTKSCVLPGGNFAGTREEYAVSLRRRFPFISVELARHYART
YGSNSEQLLKGATSLADLGELFGHHFYEAELRYLVENEWVRATDDAIWRRTKEGMWLNEA
QQSRIGEWLAQHAKPLLSLAS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacctgatcgtaatcggcggcggcataaatggtgccggcatcgcggct
gatgccgccgggcgcgggctgtcggtgctgatgctggaggcgcaagatctcgcctgcgcc
acctcctctgccagttcaaaactgatccacggcggcctgcgctacctggaacactacgaa
ttccgtctggtcggcgaagcgctggccgagcgcgaagtgctgttgaaaatggcaccacat
attgccttcccgatgcgctttttgctgccgcatcgcccgcatctgcgcccggcgtggatg
atccgcatgggtctgtttatgtacgatcacctgggaaagcgtaccagcctgccgggcagt
aaaagcgtgctttttggttcggactcaatactaaagcctgaaatcgtgcgcggtttcgaa
tattctgactgctgggtagacgatgcccgtctggtggtgcttaacgcgcaagaggtcgag
aaacgtggtggcacagtccgcacccgcacccgcgtaacccgcgcccggcgtgaaaatggc
ctgtggatcgttgaagctgaagatatcgacagcggcaaaatcttcacctggcgtgccaaa
ggtctggttaatgccgccggtccgtgggtcaaacagctgtttgatgacggcctgaaactc
aagtcgccgtacggtattcgcctgatcaaaggcagccatatcgtcgtgccgcgcattggt
tcgcagaagcaggcctatattttacagaacgaagataaccgcatcgtgttcgttattccg
tggatggatgagttctcgattatcggcaccaccgacgtggagtacaaaggtgatgcgcat
aatgtcaaaattgatgataacgagatcgattatctgctgaaggtatttaacgcgcacttt
aagcaagacctgtcccgcgacgatatcgtctggagctactccggcgtgcgcccactgtgt
gatgacgagtcagattccccacaggccatcacccgcgattatacgctggatgtgcatgat
gatggcggtcaggcacctttgctgtcggtgttcggcggtaagctcaccacctaccgcaag
ctggccgaacatgcgatggaaaaattaagcaaatactatccgcatgcgggagcagcctgg
accaaaagctgcgtgctgccgggcggaaactttgccggaacgcgtgaagagtatgccgtc
agcctgcgccgccgtttcccgtttatcagcgttgagctggcgcgccactatgcgcgtacc
tacggcagtaatagcgagcagctgctaaaaggcgcgaccagcctggcagacctgggcgaa
ctgtttggacaccatttctatgaagccgagctgcgctacctggtggagaatgagtgggtt
cgcgccaccgatgatgctatctggcgccgtaccaaagaaggcatgtggctgaacgaagcg
cagcagtcacgcataggtgagtggctggcgcaacatgccaaacctttgttatcactggca
tcctga

DBGET integrated database retrieval system