KEGG   Erwinia pyrifoliae Ep1/96: EpC_36430Help
Entry
EpC_36430         CDS       T01000                                 

Gene name
sodA
Definition
(GenBank) Manganese superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
epy  Erwinia pyrifoliae Ep1/96
Brite
Enzymes [BR:epy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     EpC_36430 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CAX57423
LinkDB All DBs
Position
complement(3967290..3967907)
Genome map
AA seq 205 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQAYVNNANAALEGTEFANLPVEELIAKL
DQLPADKKGPLRNNAGGHANHSFFWKGLKTGTSLGGDLKAAIEKDFGSVDAFKAEFEKAA
TTRFGSGWAWLVKKGDKLAVVSTANQDSPLMGEAISGASGTPIVGLDVWEHAYYLKYQNK
RPDYIKAFWDVVNWDQAAANFAAAK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagttatacactaccatccctgccttatgcctacgacgcactggaaccccatttcgac
aagcagacgatggaaatccaccacaccaaacaccatcaggcctacgtgaataacgccaat
gccgcgctggaaggtaccgagttcgctaacctgccggttgaagagctgatcgccaaactg
gatcagctgccagccgataagaaaggcccactgcgtaataacgcgggtggccacgctaac
cacagcttcttctggaaaggtttgaaaaccggcacctctctgggcggcgatctcaaagca
gccatcgagaaagatttcggtagcgttgacgccttcaaggcagaattcgaaaaagcggca
accacccgtttcggttccggctgggcgtggctggtgaaaaaaggcgacaagctggcggtg
gtttctaccgctaaccaggacagccctctgatgggcgaagccatctctggcgcatccggc
accccgatcgttggtcttgatgtgtgggaacacgcctactacctgaaataccagaacaaa
cgccctgactacatcaaggctttctgggatgtggtgaactgggatcaggcagcagcgaac
ttcgccgccgctaagtaa

DBGET integrated database retrieval system