KEGG   Equus przewalskii (Przewalski's horse): 103541040Help
Entry
103541040         CDS       T04644                                 

Gene name
TGM6
Definition
(RefSeq) transglutaminase 6
  KO
K05624  transglutaminase 6 [EC:2.3.2.13]
Organism
epz  Equus przewalskii (Przewalski's horse)
Brite
KEGG Orthology (KO) [BR:epz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103541040 (TGM6)
Enzymes [BR:epz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     103541040 (TGM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core FixG_C
Motif
Other DBs
NCBI-GeneID: 103541040
NCBI-ProteinID: XP_008505973
LinkDB All DBs
Position
Un
AA seq 705 aa AA seqDB search
IRVTEVDWQQLRNGAAHHTQEYPGPELVVRRGQIFTITLELNRSLDSEETFIFTVETGPQ
ASEGLRTKAVFQTSTSELEVGDAWTAVKEAQAEDTVTVSLASPPNAVIGRYLLSARVSSR
RKHSDRKLGEFILLFNPWCPEDNVFLASEEERQEYVLNDSGIIFRGVEKHIRAQGWNFGQ
FEEDILNICLSILDRSPSHQDDPATDVSHRHDPIYVTRAISAMVNSNNDRGVVQGQWQRK
YGGGTSPLHWRGSVAILQQWFKGRFKPVKYGQCWVFAGVMCTVLRCLGIATRVVSNFNSA
HDTDRSLSVDKYVDSFGRTLEYLTEDSMWNFHVWNESWFARQDLGPFYSGWQVLDATPQE
ESEGVFRCGPASVAAIREGDVHLAHDGPFVFSEVNADYITWLWNEDESRERVYSDTKKIG
RCISTKAVGSDSRVDITGLYKYPEGSRKERQVYRRAVKKLFSVEASGRRARVRRASGRGL
WRDDLLQPAAKPSITGKFKVLEPPKLGHDLRLALCLANLTSQTQQVQVNLSGATILYTRR
PVAEILQESHKVRLGPEEERKIPITISYSQYKEDLTEDKKILLAAMCLVTKGEKLLVEKD
ITLEDFITIKVLGPAVVGMAVVVEVMVVNPLLERVEDCVLMVEGSGLLRGQLSIDVPSLE
PQERASVRFNITPSKSGPRQLQVDLVSPHFPDIKGFVIIHVAKAK
NT seq 2120 nt NT seq  +upstreamnt  +downstreamnt
ggatcagagtcaccgaggtggactggcagcagctgaggaatggcgctgcccaccacaccc
aggagtaccccggccctgagctggtggttcgcaggggccagatattcaccatcacactgg
agctaaacagatccctggacagcgaggagaccttcatcttcactgtggagacaggacccc
aggcttctgagggcctccgcaccaaagctgtgttccagacgtcgacatcggagctggagg
tgggcgatgcctggacagcagtgaaggaggctcaggcagaggacacagtgaccgttagcc
tcgccagccctcccaacgccgtcattggccgctacctactgagcgccagggtttcctctc
gtcgcaaacacagtgaccggaagctgggcgagttcattctcctgttcaacccatggtgcc
cagaggacaacgtgtttctggcctcagaggaggagagacaggagtatgtgctcaacgaca
gcgggatcatcttccgaggcgtggagaagcacatccgagcccaaggctggaacttcgggc
agttcgaggaggacatcctgaacatctgcctctccatcctggaccgaagccccagtcacc
aagatgacccagccacggacgtgtcccaccgccacgaccccatctatgtgaccagggcca
tcagcgccatggtgaacagcaacaacgaccgcggcgtggtccagggccagtggcagcgca
agtacggcggcggcaccagccccctgcactggcgcggcagcgtggccatcctgcagcagt
ggttcaagggcaggttcaagccagtcaaatacggccagtgctgggtcttcgctggagtca
tgtgcacagtccttaggtgcttggggatcgcaacacgggttgtgtccaactttaactcgg
cccatgacacggacagaagcctgagtgtggacaaatacgtggactccttcgggcggaccc
tggagtacctgacagaggacagcatgtggaatttccatgtctggaatgagagctggtttg
cccggcaggacctgggccccttttacagcggctggcaggttctggacgccaccccgcagg
aggagagcgaaggcgtgttccgctgcggccccgcctcggtcgccgccatccgcgagggcg
acgtgcacctggcccacgacggcccctttgtgttttcggaggtcaacgcggactacatca
cctggctctggaatgaggatgagagccgggagcgcgtgtactcggacacgaagaagatcg
ggaggtgcatctccaccaaggcggtgggcagcgactcccgcgtggacatcacgggcctct
acaagtatccggaagggtcccggaaggagaggcaggtgtacaggagggccgtgaagaagc
ttttcagcgtggaagcctctgggaggagggcccgagtccgcagggccagcggccgaggtc
tctggcgtgatgacctcctgcagcccgctgccaagcccagcatcaccggcaagttcaagg
tgctggagccccccaagttgggccacgatctgaggctggccctgtgcctggccaacctca
cctcccagacccagcaggtccaagtcaacctgagtggtgccaccatcctctacacccgca
ggccagtggcagagatcctgcaagaatcccacaaggtgcggctggggccggaagaagaga
gaaagatcccaatcacaatatcttattctcaatataaggaagacctgacagaggacaaga
agatcctgttggctgctatgtgccttgtcaccaaaggagagaagctcctggtggagaagg
acattactctagaggatttcatcaccatcaaggtgctgggcccggccgtggttgggatgg
cagtggtggtagaagtgatggtggtcaatcctctcttggagagagtggaggactgtgtgc
tgatggtggaaggaagtggccttctccggggacagctcagcattgatgtgccaagcctgg
agccccaggaaagggcctcggtccgattcaacatcaccccctccaagagtggcccaaggc
agctgcaggtggacctcgtcagcccccatttcccagacatcaagggctttgtgatcatcc
acgtggccaaagccaagtga

DBGET integrated database retrieval system