KEGG   Equus przewalskii (Przewalski's horse): 103542696Help
Entry
103542696         CDS       T04644                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00250  Alanine, aspartate and glutamate metabolism
epz00410  beta-Alanine metabolism
epz00430  Taurine and hypotaurine metabolism
epz00650  Butanoate metabolism
epz01100  Metabolic pathways
epz04727  GABAergic synapse
epz04940  Type I diabetes mellitus
Module
epz_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    103542696 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103542696 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103542696 (GAD1)
   00430 Taurine and hypotaurine metabolism
    103542696 (GAD1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    103542696 (GAD1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    103542696 (GAD1)
Enzymes [BR:epz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     103542696 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS OKR_DC_1 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 103542696
NCBI-ProteinID: XP_008507847
LinkDB All DBs
Position
Un
AA seq 566 aa AA seqDB search
YDTWCGVAHGCTRKLGLKICGFLQRTNSLEEKSRLVSAFKERQSSKNLLSCENSDRDGRF
RRTETDFSNLFARDLLPAKNGEEQTVQFLLEVVDILLNYVRKTFDRSTKVLDFHHPHQLL
EGMEGFNLELSDHPESLEQILVDCRDTLKYGVRTGHPRFFNQLSTGLDIIGLAGEWLTST
ANTNMFTYEIAPVFVLMEQITLKKMREIVGWSSKDGDGIFSPGGAISNMYSIMAARYKYF
PEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAALGFGTDNVILIKCNERGKIIPADLQAKI
LEAKQKGYVPLYVNATAGTTVYGAFDPIQEIADICEKYNLWLHVDAAWGGGLLMSRKHRH
KLSGIERADSVTWNPHKMMGVLLQCSAILVKEKGILQGCNQMCAGYLFQPDKQYDVSYDT
GDKAIQCGRHVDIFKFWLMWKAKGTVGFENQINKCLELAEYLYAKIKNREEFEMVFDGEP
EHTNVCFWYIPQSLRGVPDSPERREKLHRVAPKIKALMMESGTTMVGYQPQGDKANFFRM
VISNPAATQSDIDFLIEEIERLGQDL
NT seq 1703 nt NT seq  +upstreamnt  +downstreamnt
cgtatgacacctggtgcggcgtggcccatggatgcaccagaaaactggggctcaagatct
gcggcttcttgcaaaggaccaacagcctggaagagaagagccggcttgtgagcgccttca
aggagaggcagtcctccaagaacctgctttcttgtgaaaacagtgacagagatggccgct
tccggcgtacggagaccgacttctccaacctgtttgctcgagatctgcttccagctaaga
atggggaggagcaaactgtgcagttcttactggaggtggtggacatactcctcaactatg
tccgcaagacattcgatcgctccaccaaggtgctggacttccatcacccacaccagctgc
tggaaggcatggagggcttcaacttggagctctctgaccaccccgagtccttggagcaga
tcctggtggactgcagagacaccctgaagtacggggtccgtacaggtcatcctcgatttt
tcaatcagctctccactggattggatatcattggtttagccggcgaatggctgacatcaa
ctgccaataccaatatgtttacatatgaaattgcaccagtgtttgttctcatggagcaaa
taacacttaagaagatgagagagatagttggatggtcaagtaaagatggtgatgggatat
tttctcctgggggagctatatccaacatgtacagcatcatggctgctcgatacaagtact
tcccggaagttaagacaaagggcatggcggcggtgcccaaactggtcctcttcacctcag
aacatagtcactattccataaagaaagctggggctgcacttggctttggaaccgacaatg
tgattttgataaagtgcaatgaaagggggaaaataattccagctgatttacaggcaaaaa
ttcttgaagccaagcaaaagggatacgttcctctttatgtcaatgcaactgctggcacaa
ctgtttatggggcttttgatccgatacaggagattgcagatatatgcgagaaatataacc
tctggctgcacgtcgatgctgcctggggcggtgggctactcatgtccaggaagcaccgcc
ataagctcagtggcatagaaagggccgactcagtcacctggaaccctcacaagatgatgg
gcgtgctgttgcagtgctctgccatcctcgtcaaggaaaagggtatactccaaggatgca
accagatgtgtgcaggatacctcttccagccagacaagcagtatgatgtctcctacgaca
ctggggacaaggcaattcagtgtggccgccatgtggacattttcaagttctggctgatgt
ggaaagcaaaggggacagtgggatttgaaaatcagatcaacaaatgcttggaactggctg
aatacctctatgctaagattaaaaacagagaagaatttgagatggtttttgatggtgagc
ctgagcatacaaacgtctgtttctggtatattccacaaagcctcaggggcgttccggata
gccctgagcgacgggaaaaactccacagggtggctcccaaaattaaagccctgatgatgg
agtctggcacgaccatggttggctaccagcctcagggggacaaggccaacttcttccgga
tggtcatctcaaacccagctgctacccagtctgatatcgacttcctcattgaggagatag
aaagactgggccaggatctgtaa

DBGET integrated database retrieval system