KEGG   Equus przewalskii (Przewalski's horse): 103543692
Entry
103543692         CDS       T04644                                 

Gene name
RELA
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz01523  Antifolate resistance
epz04010  MAPK signaling pathway
epz04014  Ras signaling pathway
epz04024  cAMP signaling pathway
epz04062  Chemokine signaling pathway
epz04064  NF-kappa B signaling pathway
epz04066  HIF-1 signaling pathway
epz04071  Sphingolipid signaling pathway
epz04137  Mitophagy - animal
epz04151  PI3K-Akt signaling pathway
epz04210  Apoptosis
epz04211  Longevity regulating pathway
epz04218  Cellular senescence
epz04380  Osteoclast differentiation
epz04620  Toll-like receptor signaling pathway
epz04621  NOD-like receptor signaling pathway
epz04622  RIG-I-like receptor signaling pathway
epz04623  Cytosolic DNA-sensing pathway
epz04625  C-type lectin receptor signaling pathway
epz04657  IL-17 signaling pathway
epz04658  Th1 and Th2 cell differentiation
epz04659  Th17 cell differentiation
epz04660  T cell receptor signaling pathway
epz04662  B cell receptor signaling pathway
epz04668  TNF signaling pathway
epz04722  Neurotrophin signaling pathway
epz04917  Prolactin signaling pathway
epz04920  Adipocytokine signaling pathway
epz04926  Relaxin signaling pathway
epz04931  Insulin resistance
epz04932  Non-alcoholic fatty liver disease
epz04933  AGE-RAGE signaling pathway in diabetic complications
epz05010  Alzheimer disease
epz05022  Pathways of neurodegeneration - multiple diseases
epz05030  Cocaine addiction
epz05132  Salmonella infection
epz05133  Pertussis
epz05134  Legionellosis
epz05135  Yersinia infection
epz05140  Leishmaniasis
epz05142  Chagas disease
epz05145  Toxoplasmosis
epz05146  Amoebiasis
epz05152  Tuberculosis
epz05160  Hepatitis C
epz05161  Hepatitis B
epz05162  Measles
epz05163  Human cytomegalovirus infection
epz05164  Influenza A
epz05165  Human papillomavirus infection
epz05166  Human T-cell leukemia virus 1 infection
epz05167  Kaposi sarcoma-associated herpesvirus infection
epz05168  Herpes simplex virus 1 infection
epz05169  Epstein-Barr virus infection
epz05170  Human immunodeficiency virus 1 infection
epz05200  Pathways in cancer
epz05202  Transcriptional misregulation in cancer
epz05203  Viral carcinogenesis
epz05212  Pancreatic cancer
epz05215  Prostate cancer
epz05220  Chronic myeloid leukemia
epz05221  Acute myeloid leukemia
epz05222  Small cell lung cancer
epz05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
epz05321  Inflammatory bowel disease
epz05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103543692 (RELA)
   04014 Ras signaling pathway
    103543692 (RELA)
   04064 NF-kappa B signaling pathway
    103543692 (RELA)
   04668 TNF signaling pathway
    103543692 (RELA)
   04066 HIF-1 signaling pathway
    103543692 (RELA)
   04071 Sphingolipid signaling pathway
    103543692 (RELA)
   04024 cAMP signaling pathway
    103543692 (RELA)
   04151 PI3K-Akt signaling pathway
    103543692 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103543692 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    103543692 (RELA)
   04218 Cellular senescence
    103543692 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103543692 (RELA)
   04621 NOD-like receptor signaling pathway
    103543692 (RELA)
   04622 RIG-I-like receptor signaling pathway
    103543692 (RELA)
   04623 Cytosolic DNA-sensing pathway
    103543692 (RELA)
   04625 C-type lectin receptor signaling pathway
    103543692 (RELA)
   04660 T cell receptor signaling pathway
    103543692 (RELA)
   04658 Th1 and Th2 cell differentiation
    103543692 (RELA)
   04659 Th17 cell differentiation
    103543692 (RELA)
   04657 IL-17 signaling pathway
    103543692 (RELA)
   04662 B cell receptor signaling pathway
    103543692 (RELA)
   04062 Chemokine signaling pathway
    103543692 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103543692 (RELA)
   04917 Prolactin signaling pathway
    103543692 (RELA)
   04926 Relaxin signaling pathway
    103543692 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103543692 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103543692 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    103543692 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103543692 (RELA)
   05202 Transcriptional misregulation in cancer
    103543692 (RELA)
   05203 Viral carcinogenesis
    103543692 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103543692 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103543692 (RELA)
   05221 Acute myeloid leukemia
    103543692 (RELA)
   05220 Chronic myeloid leukemia
    103543692 (RELA)
   05215 Prostate cancer
    103543692 (RELA)
   05222 Small cell lung cancer
    103543692 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103543692 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103543692 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    103543692 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    103543692 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103543692 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103543692 (RELA)
   04931 Insulin resistance
    103543692 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103543692 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103543692 (RELA)
   05135 Yersinia infection
    103543692 (RELA)
   05133 Pertussis
    103543692 (RELA)
   05134 Legionellosis
    103543692 (RELA)
   05152 Tuberculosis
    103543692 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103543692 (RELA)
   05170 Human immunodeficiency virus 1 infection
    103543692 (RELA)
   05162 Measles
    103543692 (RELA)
   05164 Influenza A
    103543692 (RELA)
   05161 Hepatitis B
    103543692 (RELA)
   05160 Hepatitis C
    103543692 (RELA)
   05168 Herpes simplex virus 1 infection
    103543692 (RELA)
   05163 Human cytomegalovirus infection
    103543692 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103543692 (RELA)
   05169 Epstein-Barr virus infection
    103543692 (RELA)
   05165 Human papillomavirus infection
    103543692 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103543692 (RELA)
   05145 Toxoplasmosis
    103543692 (RELA)
   05140 Leishmaniasis
    103543692 (RELA)
   05142 Chagas disease
    103543692 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    103543692 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:epz03000]
    103543692 (RELA)
Transcription factors [BR:epz03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    103543692 (RELA)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind Fimbrial_CS1
Other DBs
NCBI-GeneID: 103543692
NCBI-ProteinID: XP_008508783
LinkDB
Position
Un
AA seq 504 aa
MNKCRGLEVGTGRGSRAQTLLETVATDAGGDLSFQNLGIQCVKKRDLEQAISQRIQTNNN
PFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLSPVLSHPIFDNRAPNTAELKICRV
NRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYAD
PSLQAPVRVSMQLRRPSDRELSEPMEFQYLHADPSLQAPVRVSMQLRRPSDRELSEPMEF
QYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPARSSASVPKPAP
QPYPFTPSLSTINFEEFSPMVFPSGTIPSQXALAPAPAPVLAQAPAPAPAMASALAQAPA
PVPVLAAGLAQAVAPPAPRTTQAGEGTLTEALLQLQFDADEDLGALLGNNTDPAVFTDLA
SVDNSEFQQLLNQGVSMAPHTAEPMLMEYPEAITRLMSGSQRPPDPAPAPLGASGLPNGL
LSGDEDFSSISDMDFSALLSQISS
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgaacaagtgccgaggccttgaagtcggaactgggcgaggcagtagggcccagactctg
ctggagacagtggcaactgacgccgggggggacctcagcttccagaacctggggatccag
tgtgtaaagaagcgagacctggagcaggccatcagtcagcgcatccagaccaacaacaac
cccttccaagttcccatagaagagcagcgtggggactacgacctgaatgcggtgcggcta
tgcttccaggtgacagtgcgggacccggcaggcaggcccctccgcctgtcgcctgtcctt
tctcatcccatctttgacaaccgcgcccccaacactgctgagctcaagatctgccgagtg
aaccggaactccgggagctgcctcgggggcgatgagatcttcctgctttgtgacaaggtg
cagaaagaggacatcgaggtgtatttcacgggaccaggctgggaggcccgaggctccttt
tcacaagccgatgttcaccgacaagtggccattgtgttccggacacctccctacgcggac
cccagcctgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcggatcgggag
ctcagcgagcccatggagttccagtatttgcacgcggaccccagcctgcaggcccccgtg
cgtgtctccatgcagctgcggcggccttcggatcgggagctcagcgagcccatggagttc
cagtatttgccagacacagatgatcgtcaccgaattgaggagaaacgcaaaaggacatat
gagaccttcaagagcatcatgaaaaagagtcctttcaatggacccaccgacccccggccc
ccgccccggcgcattgctgtgcctgcccgcagctcagcctccgtccccaagccagctccc
cagccctatccctttacgccatccctcagcaccatcaactttgaggaattttcccccatg
gtctttccttctgggacgatcccaagccagnnggccttggccccagcccctgccccagtc
ctggcgcaggccccagcccctgccccagccatggcatcagctctggcccaggccccagct
cccgtccctgtcctagccgcaggccttgctcaggccgtggccccgcctgcccccaggacc
acccaagctggggaagggacactgacggaggccctgctgcagctgcagtttgatgctgat
gaagacctgggggccctgctcggcaataacactgacccggccgtgttcacggacctggca
tctgtcgacaactctgagtttcagcagctgctgaaccagggtgtctctatggccccccac
acagctgagcccatgctgatggagtaccctgaggctataactcgcctgatgtcagggtcc
cagcggccccctgacccagctcccgctcccctgggggcctctgggctccccaacggtctc
ctctcaggggacgaagacttctcctccatttcggacatggacttctcagcccttctgagt
cagatcagctcctag

DBGET integrated database retrieval system