KEGG   Equus przewalskii (Przewalski's horse): 103543855Help
Entry
103543855         CDS       T04644                                 

Gene name
HTR1A
Definition
(RefSeq) 5-hydroxytryptamine receptor 1A
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04024  cAMP signaling pathway
epz04080  Neuroactive ligand-receptor interaction
epz04726  Serotonergic synapse
epz04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    103543855 (HTR1A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103543855 (HTR1A)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    103543855 (HTR1A)
  09157 Sensory system
   04742 Taste transduction
    103543855 (HTR1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:epz04030]
    103543855 (HTR1A)
G protein-coupled receptors [BR:epz04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    103543855 (HTR1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 103543855
NCBI-ProteinID: XP_008508916
LinkDB All DBs
Position
Un
AA seq 422 aa AA seqDB search
MDVLGPGQGNNTTSSEGPFGTRANATGISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLFAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLVGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKKGADS
CLGASPAPQRKKSANGELGSREWRQGVENKAGGVLCANGAVRQGDDGAALEVIEVHRMGN
SKEHLPLPSEAGAIPCAPAFFEKKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKILKCKFC
RR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggatgtactcggccctggacaaggcaacaacaccacatcttccgagggtcccttcgga
acacgcgccaacgctactggcatctctgatgtgaccttcagctaccaagtgatcacctct
ctgctactgggcacgctcatcttctgcgcggtgctgggcaatgcgtgcgtggtggccgcc
atcgccctcgagcgctccctgcagaacgtggccaactatctcatcggctccctggccgtc
accgacctcatggtgtcggtgctggtgctgcctatggccgcgttgtaccaggtactcaac
aagtggacgctgggacaggtcacctgtgacctgttcatcgcccttgacgtactgtgctgc
acctcgtccattctgcacctgttcgccatcgcgctggacaggtactgggccatcacggac
cccatcgactacgtgaacaagaggacacctcggcgcgctgccgcgctcatctcgctcact
tggctcgttggcttcctcatctccatcccaccgatgctgggatggcgcacccccgaagac
cgctcagaccccgacgcgtgcaccatcagcaaggaccatggctacactatctactccacc
ttcggcgctttctacatcccgctgctgctcatgctggttctctatgggcgcatctttaga
gccgcgcgcttccgcatccgcaagacagtcaagaaggtggagaagaagggagcggactcc
tgccttggggcgtcgccagccccgcagcgcaagaagagcgcaaatggcgagctagggagc
agagagtggaggcagggcgtggagaacaaggcagggggggttctgtgcgccaatggcgct
gtgaggcagggtgacgacggcgccgccctggaggtgatcgaagtgcaccggatgggcaac
tccaaagagcacctgccgctgccaagcgaggccggtgctatcccctgcgctcccgccttc
ttcgagaagaaaaatgagcgcaacgccgaggccaagcgcaagatggccctggcccgcgaa
aggaagacggtgaagacgctgggcatcatcatgggcaccttcattctctgctggttgccc
ttcttcatcgtggccctagtcttgcccttctgcgagagcagctgccatatgcccaccctg
ttgggcgccataatcaactggctgggttactccaactctctgctcaaccctgtcatttat
gcctatttcaacaaggactttcaaaacgcatttaagaagatcctcaagtgcaagttctgc
cgccgatga

DBGET integrated database retrieval system