KEGG   Equus przewalskii (Przewalski's horse): 103543979
Entry
103543979         CDS       T04644                                 

Definition
(RefSeq) NF-kappa-B essential modulator-like
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz01523  Antifolate resistance
epz04010  MAPK signaling pathway
epz04014  Ras signaling pathway
epz04062  Chemokine signaling pathway
epz04064  NF-kappa B signaling pathway
epz04151  PI3K-Akt signaling pathway
epz04210  Apoptosis
epz04380  Osteoclast differentiation
epz04620  Toll-like receptor signaling pathway
epz04621  NOD-like receptor signaling pathway
epz04622  RIG-I-like receptor signaling pathway
epz04623  Cytosolic DNA-sensing pathway
epz04625  C-type lectin receptor signaling pathway
epz04657  IL-17 signaling pathway
epz04658  Th1 and Th2 cell differentiation
epz04659  Th17 cell differentiation
epz04660  T cell receptor signaling pathway
epz04662  B cell receptor signaling pathway
epz04668  TNF signaling pathway
epz04920  Adipocytokine signaling pathway
epz05132  Salmonella infection
epz05135  Yersinia infection
epz05142  Chagas disease
epz05145  Toxoplasmosis
epz05160  Hepatitis C
epz05161  Hepatitis B
epz05162  Measles
epz05163  Human cytomegalovirus infection
epz05164  Influenza A
epz05165  Human papillomavirus infection
epz05166  Human T-cell leukemia virus 1 infection
epz05167  Kaposi sarcoma-associated herpesvirus infection
epz05168  Herpes simplex virus 1 infection
epz05169  Epstein-Barr virus infection
epz05170  Human immunodeficiency virus 1 infection
epz05200  Pathways in cancer
epz05203  Viral carcinogenesis
epz05212  Pancreatic cancer
epz05215  Prostate cancer
epz05220  Chronic myeloid leukemia
epz05221  Acute myeloid leukemia
epz05222  Small cell lung cancer
epz05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
epz05340  Primary immunodeficiency
epz05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103543979
   04014 Ras signaling pathway
    103543979
   04064 NF-kappa B signaling pathway
    103543979
   04668 TNF signaling pathway
    103543979
   04151 PI3K-Akt signaling pathway
    103543979
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103543979
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103543979
   04621 NOD-like receptor signaling pathway
    103543979
   04622 RIG-I-like receptor signaling pathway
    103543979
   04623 Cytosolic DNA-sensing pathway
    103543979
   04625 C-type lectin receptor signaling pathway
    103543979
   04660 T cell receptor signaling pathway
    103543979
   04658 Th1 and Th2 cell differentiation
    103543979
   04659 Th17 cell differentiation
    103543979
   04657 IL-17 signaling pathway
    103543979
   04662 B cell receptor signaling pathway
    103543979
   04062 Chemokine signaling pathway
    103543979
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103543979
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103543979
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103543979
   05203 Viral carcinogenesis
    103543979
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103543979
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103543979
   05221 Acute myeloid leukemia
    103543979
   05220 Chronic myeloid leukemia
    103543979
   05215 Prostate cancer
    103543979
   05222 Small cell lung cancer
    103543979
  09163 Immune disease
   05340 Primary immunodeficiency
    103543979
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103543979
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103543979
   05135 Yersinia infection
    103543979
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103543979
   05170 Human immunodeficiency virus 1 infection
    103543979
   05162 Measles
    103543979
   05164 Influenza A
    103543979
   05161 Hepatitis B
    103543979
   05160 Hepatitis C
    103543979
   05168 Herpes simplex virus 1 infection
    103543979
   05163 Human cytomegalovirus infection
    103543979
   05167 Kaposi sarcoma-associated herpesvirus infection
    103543979
   05169 Epstein-Barr virus infection
    103543979
   05165 Human papillomavirus infection
    103543979
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103543979
   05142 Chagas disease
    103543979
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    103543979
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:epz01001]
    103543979
Protein kinases [BR:epz01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   103543979
SSDB
Motif
Pfam: CC2-LZ zf_C2H2_10 zf_C2H2_ZHX LLC1
Other DBs
NCBI-GeneID: 103543979
NCBI-ProteinID: XP_008509055
LinkDB
Position
Un
AA seq 278 aa
MAWTLLRARRVAPVTLCSCRGSAVTAPFPCARARAASEQARQLESEREALQQQHNVQVDQ
LRMQTQSMEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSMVSSERNRGMQLE
DLKQQLQQAEEALVAKQEAIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREK
LAEKKECLQEQLEQLQREYSRLKASCQESARIEDMRKRHVEVSQPPLPPTPAHHSIHSAL
PSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 837 nt   +upstreamnt  +downstreamnt
atggcttggaccctcctccgagcacggcgggtggcgcctgtcaccctctgctcctgccgg
ggctctgctgtgaccgcccccttcccctgtgccagggcccgggcggccagtgagcaggcc
cggcagctggagagtgagcgggaggcgctgcagcagcagcacaacgtgcaggtggaccag
ctgcgcatgcagacccagagcatggaggctgccctgcgcatggagcgccaggctgcctcg
gaggagaagcggaagctggcccagctacaggtagcctatcaccagctcttccaagagtat
gacaaccacatcaagagcagcatggtgagcagtgagcggaaccgaggaatgcagctggaa
gatcttaagcagcagctccagcaggccgaggaggccctggtggccaaacaggaagcgatt
gacaagctcaaggaagaggccgagcagcataagattgtgatggagaccgttccggtgctg
aaggcccaggcggatatctacaaggcggacttccaggcggaaaggcaggcccgggagaag
ctggctgagaaaaaggagtgtctgcaggagcagctggagcagctgcagagggagtacagc
cggttgaaggccagctgtcaggagtcagccaggatcgaagatatgaggaagcggcatgta
gaggtctcccagccccccttaccccccaccccagctcaccactccattcactcggccctg
cccagccagaggagaagtccccccgaggagccacccgacttctgttgccccaagtgccag
taccaggctcctgacatggacaccctgcagatacacgtcatggagtgcatcgagtag

DBGET integrated database retrieval system