KEGG   Equus przewalskii (Przewalski's horse): 103546788Help
Entry
103546788         CDS       T04644                                 

Gene name
PFKM
Definition
(RefSeq) phosphofructokinase, muscle
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00010  Glycolysis / Gluconeogenesis
epz00030  Pentose phosphate pathway
epz00051  Fructose and mannose metabolism
epz00052  Galactose metabolism
epz01100  Metabolic pathways
epz01200  Carbon metabolism
epz01230  Biosynthesis of amino acids
epz03018  RNA degradation
epz04152  AMPK signaling pathway
epz05230  Central carbon metabolism in cancer
Module
epz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103546788 (PFKM)
   00030 Pentose phosphate pathway
    103546788 (PFKM)
   00051 Fructose and mannose metabolism
    103546788 (PFKM)
   00052 Galactose metabolism
    103546788 (PFKM)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    103546788 (PFKM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    103546788 (PFKM)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    103546788 (PFKM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:epz01009]
    103546788 (PFKM)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:epz03019]
    103546788 (PFKM)
Enzymes [BR:epz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     103546788 (PFKM)
Protein phosphatases and associated proteins [BR:epz01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103546788 (PFKM)
Messenger RNA biogenesis [BR:epz03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     103546788 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 103546788
NCBI-ProteinID: XP_008511829
LinkDB All DBs
Position
Un
AA seq 937 aa AA seqDB search
MRRGFRPGAERKTREPPRTGTASTTPEEPLGGRGGGGGGAVGQRAELRTAGTPAQCGEAG
EAKGASKAVVIISLFPFQFELFLETAMRKEELHLKFFMCVIQSRQLVRTPQRTAGEASTS
SMLIQKPPPETDASKILDTMDAPDTMEGIHVLKNEWIMTHEEHHAAKTLGIGKAIAVLTS
GGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIREATWESVSMMLQLGGTV
IGSARCKDFREREGRLRAAHNLVKLGITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKAG
KITAEEATKSNYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIIEIVDAITTTAQSHQRTF
VLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWEDHLCRRLSETRTRGSRLNIIIVA
EGAIDRNGKPITSESIKDLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMA
LLEATPDTPACVVSLSGNQAVRLPLMECVQVTKDVTKAMAERKFDEAMKLRGRSFMNNWE
VYKLLAHIRPPVSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGL
AKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPRKSFEQISANITKFNIQGLIIVGGFEAYT
GGLELMEGRKQYDELCIPFVVIPATVSNNVPGSDFSVGADTALNTICMTCDRIKQSAAGT
KRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPFTIRDLQVNVEHLVQKMKTTVKRG
LVLRNEKCNENYSTDFIFNLYSEEGKGIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKA
MNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVTELKEQTDFEHRIPKEQWWL
KLRPILKILAKYEIDLDTSEHAHLEHISRKRSGEAPA
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaggggtttccggccgggcgcggaacgcaaaacccgggaaccgccgcgaaccgga
accgcctccacaacaccggaagagccgctaggtggccgcggaggaggggggggtggggcg
gtaggtcaaagagcagagttgaggaccgccggaacgcctgcgcagtgtggcgaggccgga
gaagccaagggagcatctaaggctgtagtcataatttcgctgttcccttttcagtttgag
ctttttcttgagacagccatgcgtaaagaggaattacatctgaaatttttcatgtgtgtg
attcaatctcgccaattagtcaggactcctcagagaacagctggggaagcttcaacttcc
agcatgctcatacaaaagccaccacctgagacagacgcctcgaagattctagatactatg
gatgctccagacaccatggaaggcatacatgttttgaaaaatgagtggatcatgacccat
gaagagcaccatgcagccaaaaccctggggatcggcaaagccatcgccgtgttaacctct
ggtggagatgcccaaggtatgaatgctgctgtcagggctgtggttcgagttggtatcttc
actggtgcccgtgtcttctttgtccatgagggttatcaaggcctggtggatggtggagac
cacatcagggaggccacctgggagagcgtttcgatgatgcttcagctgggtggcacagtg
attggaagtgcccggtgcaaggactttcgggaacgagagggacgactccgagctgcccac
aacctggtgaagcttgggattaccaacctgtgtgtcattgggggcgatggtagcctcact
ggggctgacaccttccgttctgagtggagtgacttgttgagtgacctccagaaagcgggt
aagatcacagctgaggaggctacgaagtccaactacctgaacatcgtgggcctggttggc
tcaattgacaatgacttttgcggcactgatatgaccattggcactgactctgccctgcac
cggatcatagagattgtagacgccatcactactactgctcagagccaccagaggacgttc
gtgttagaggtgatgggccggcactgtggatacctggcccttgtcacctctctctcctgt
ggggccgactgggtttttattcctgaatgtccaccagatgatgactgggaggatcatctt
tgtcgtcggctcagtgagacaaggacccgtggttctcgtctcaacatcatcattgtggct
gagggtgcgattgacaggaatgggaaaccaatcacctcagaatccatcaaggatctggtg
gtaaagcgtctgggatatgacacccgggtcaccgtcttggggcatgtgcagcgaggtggg
accccgtcagcctttgaccggatcctgggcagcaggatgggtgtggaagcagtgatggca
cttttggaggcgaccccagacaccccagcctgcgtggtgagcctctctggtaatcaggct
gtgcggctgcccctcatggagtgtgtccaggtgaccaaagatgtgaccaaggccatggct
gagaggaaatttgatgaggccatgaagctgagaggccggagcttcatgaacaactgggag
gtatacaagcttctggctcacatcagacccccagtttctaagagtggctcacacacagtg
gccgtgatgaatgtgggggccccggctgcaggcatgaatgctgccgtccgctccactgtg
agaattggcctcatccagggcaaccgagtgctggttgtgcacgatggcttcgagggcctg
gccaagggccagattgaggaagctggctggagctacgttggcggctggactggccaaggg
ggttctaaacttgggactaaaaggacgctacccaggaagagcttcgagcagatcagtgcc
aacatcactaagttcaacattcaaggcctgatcatcgttgggggcttcgaggcttacaca
gggggcctggagctgatggagggcaggaagcagtacgacgagctctgcatcccgtttgtg
gtcatccctgccacggtctccaacaacgtccctggctcagacttcagcgtgggggctgac
accgcactcaatactatctgcatgacctgtgaccgcatcaagcagtcagcagcaggtacc
aagcgtcgagtgtttatcattgaaaccatgggtggctactgtggctacctggctaccatg
gcaggactggcagctggagccgatgcggcctacattttcgaggagccattcaccattcga
gacctgcaggtgaatgttgaacatctggtgcaaaagatgaaaacaactgtgaaaaggggc
ttggtgttaaggaatgagaagtgcaatgagaactatagcactgacttcattttcaacctg
tactctgaggaggggaagggcatcttcgacagcaggaagaatgtgcttggccacatgcag
cagggtgggagcccaactccatttgataggaattttgccactaagatgggtgccaaggct
atgaactggatgtctgggaaaatcaaagagagttaccgtaatgggcggatctttgccaat
accccagactcaggctgtgttctggggatgcgtaagagggccctggtctttcaaccagtg
actgagctgaaggaacagacggatttcgagcaccgcatccccaaggaacagtggtggctg
aagctgaggcccatcctcaagatcctagccaagtatgagattgacctggatacatcagag
cacgcccacctggagcacatcagtcggaagcggtctggagaagctcctgcctaa

DBGET integrated database retrieval system