KEGG   Equus przewalskii (Przewalski's horse): 103546792Help
Entry
103546792         CDS       T04644                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz05034  Alcoholism
epz05165  Human papillomavirus infection
epz05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:epz00001]
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    103546792 (HDAC7)
  09164 Substance dependence
   05034 Alcoholism
    103546792 (HDAC7)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    103546792 (HDAC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:epz03036]
    103546792 (HDAC7)
Enzymes [BR:epz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103546792 (HDAC7)
Chromosome and associated proteins [BR:epz03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     103546792 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 103546792
NCBI-ProteinID: XP_008511838
LinkDB All DBs
Position
Un
AA seq 827 aa AA seqDB search
MVNFPSQGLELLEQGSEGCPRPRADTPGPQPQPMDLRVGQRPTVEPPPEPTLLALQHPPR
LHHHLFLTGLQPQRSAEPMRVGQQEQELRQLLHKDKSKRSAVASSVVKQKLAEVILKKQQ
AALERTVHPNSPSIPYRTLEPLETEGAARSMLSSFLPPVPSLPSDPPEHFPLRKTVSEPN
LKLRYKPKKSLERRKNPLLRKESAPPSLRRRPAETLGDSSPSSSSTPASGCSSPNDSEHG
PGPGLGTEADGDHRTHLTLGPRGPVLGSPHAPLFLPHGLEPEAGGPLPSRLQPILLLDPS
APHAPLLTVPGLGPLPFHFAQSFLTTERLSGSGLHRPLSRTRSEPLPPSATAPPPLGPLQ
PRLERLKPHIQLTKRPAKSEKPRLRQIPSAEDLETDGGGVGPVGDDGLEHRESSHGHHEA
RGPVPLQQHQQVFLWDHQRLAGRLPRGSTGDSVLLPLAQGSHRPLSRAQSPPAAPASLPT
PEPASQARVLPSSEPPARTLPFTTGLVYDSVMLKHQCSCGDNSRHPEHAGRIQSIWSRLQ
ERGLRSQCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLKXXXXLYGANPLSRLKLDN
GKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSSNAARWAAGSVTDLAFKVASRELKNGF
AVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQGKASKILIVDWDVHHGNGTQQTFYQD
PSVLYISLHRHDDGNFFPGSGAVDEVGAGSGEGFNVNVAWAGGLDPPMGDPEYLAAFRIV
VMPVAREFSPDLVLVSAGFDAAEGHPAPLGGYHVSAKCKEGPAQGVV
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacttcccatctcagggattggagttactggagcaggggagtgagggctgcccc
aggccccgtgcagacacgccaggccctcagccccagcccatggacctgcgggtgggccag
cggcccacggtggagcccccaccggagcccacgctgctggccctgcagcaccccccgcgt
ctgcaccaccacctcttcctgacaggcctgcagccgcagcgctcggcggagcccatgagg
gtggggcagcaggagcaggagctgcggcagcttctccataaggacaagagcaagcgaagt
gccgtggccagcagtgtggtcaagcagaagctggcggaggtgattttgaagaaacagcag
gcagccttagagagaacagtccatcccaatagccccagcatcccctacagaactcttgag
cccttggagacggaaggtgccgcccgctccatgctcagcagctttctgcctcccgttccc
agcctgcccagtgaccccccagaacacttccctctgcgtaagacagtctcggagcccaac
ctgaagctgcgctacaagcccaagaagtcactggagcggaggaagaatccgctgctcaga
aaggagagcgccccgcccagtctccggcgccggcctgcagagaccctcggtgactcctcc
ccgagtagcagcagcacgccagcctcggggtgcagctcccccaatgacagcgagcatggc
cccggccccggcctgggcacagaggcggatggtgaccacaggacccatctaactctgggc
cctcgggggccagtcctggggagcccccatgctcccctcttcctgccccatggcctggag
cctgaggctgggggccccttgccctctcgcctgcagcccattctcctcctggatccctca
gcccctcacgcacccctgctgactgtgcccgggcttgggcccctgcccttccactttgcc
cagtccttcctgaccaccgaacggctctccgggtcaggcctccacaggccgctgagccgg
acccgctcagagcccctgcccccaagcgccaccgcccccccaccgctgggccccctgcag
ccccgcctggagcgactcaaacctcacatccagctgaccaagaggccagccaagagtgag
aagccccgactgcggcagattccctcggctgaggacctagagacggatggggggggagtg
gggccggtgggggatgacggcctggaacacagggagtcgagccatgggcaccatgaggcc
aggggccctgttcctctccagcagcaccaacaggtgttcctctgggaccatcagcgactg
gctgggcggctcccccggggcagcactggggactctgtgctgcttcccctggcccagggc
agtcaccggcccctgtccagggctcagtcgcccccagctgcgcctgcctcactgccaacc
ccagagcctgccagccaggcccgcgtcctgcccagctcagagccccccgccaggaccctg
cccttcaccacagggctggtctatgactccgtaatgctgaagcaccagtgttcctgcgga
gacaacagcaggcacccagagcatgctggccgcatccagagcatctggtcccggctgcag
gagcgggggctgcggagccagtgtgagtgtctccggggccggaaggcctccctggaggag
ctgcagtctgtgcattccgagcggcacgtgctcctctatggcaccaacccgctcagccgc
ctcaaannnnnnnnnnncctctatggcgccaacccgctcagccgcctcaaactggacaac
gggaagctggcagggctcctggcacagcggatgtttgtgatgctgccctgtggtggggtt
ggggtggatactgacaccatctggaatgagctgcactcctccaatgcagcccgttgggcc
gccggcagcgtcactgaccttgccttcaaagtggcttcccgcgaactaaagaacggtttt
gctgtggttcggcctccaggacaccatgcagaccattccactgccatgggcttctgcttc
ttcaactcagtggccatcgcctgccgacagctgcaacaacagggcaaggccagcaagatc
ctcattgtggactgggatgttcaccacggcaacggcacccagcaaaccttctaccaggac
cccagcgtgctctacatctccctgcatcgccatgacgacggcaacttcttcccaggcagt
ggggctgtggatgaggtgggagctggcagcggtgagggcttcaatgtcaacgtggcctgg
gccggaggtctggaccccccaatgggggatcctgagtacctggccgccttcaggatcgtc
gtgatgcctgttgcccgagagttctctccagacctggtcctggtgtcagctgggtttgat
gctgccgagggtcaccccgccccgctgggtggctaccatgtttccgccaaatgtaaggag
ggcccagcccagggagtggtgtag

DBGET integrated database retrieval system