KEGG   Equus przewalskii (Przewalski's horse): 103547078Help
Entry
103547078         CDS       T04644                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00590  Arachidonic acid metabolism
epz01100  Metabolic pathways
epz04064  NF-kappa B signaling pathway
epz04370  VEGF signaling pathway
epz04625  C-type lectin receptor signaling pathway
epz04657  IL-17 signaling pathway
epz04668  TNF signaling pathway
epz04723  Retrograde endocannabinoid signaling
epz04726  Serotonergic synapse
epz04913  Ovarian steroidogenesis
epz04921  Oxytocin signaling pathway
epz04923  Regulation of lipolysis in adipocytes
epz05140  Leishmaniasis
epz05163  Human cytomegalovirus infection
epz05165  Human papillomavirus infection
epz05167  Kaposi sarcoma-associated herpesvirus infection
epz05200  Pathways in cancer
epz05204  Chemical carcinogenesis
epz05206  MicroRNAs in cancer
epz05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103547078 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    103547078 (PTGS2)
   04064 NF-kappa B signaling pathway
    103547078 (PTGS2)
   04668 TNF signaling pathway
    103547078 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103547078 (PTGS2)
   04657 IL-17 signaling pathway
    103547078 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    103547078 (PTGS2)
   04913 Ovarian steroidogenesis
    103547078 (PTGS2)
   04921 Oxytocin signaling pathway
    103547078 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    103547078 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    103547078 (PTGS2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    103547078 (PTGS2)
   05206 MicroRNAs in cancer
    103547078 (PTGS2)
   05204 Chemical carcinogenesis
    103547078 (PTGS2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    103547078 (PTGS2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    103547078 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103547078 (PTGS2)
   05165 Human papillomavirus infection
    103547078 (PTGS2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    103547078 (PTGS2)
Enzymes [BR:epz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     103547078 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 103547078
NCBI-ProteinID: XP_008512298
LinkDB All DBs
Position
Un
AA seq 604 aa AA seqDB search
MLARALLLCVALALGHAANPCCSNPCQNRGVCMSVGFDQYQCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGVWNIVNSFPFLRNAVMKYVLVSRSHLIESPPTYNAQY
GYKSWESFSNLSYYTRALPPVADGCPTPMGVKGKKELPDSKEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDPKRGPAFTKGLGHGVDLSHIYGETLDRQHKLRLFKDGKMKY
QIINGEVYPPTVKDTQVEMIYPPHIPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIDDQEYNFQQFLYNNSILLEHGLTQFVESFSRQIAGRV
AGGRNVPAAAQKIAKASIDQSREMKYQSLNEYRKRFRLTPYKSFEELTGEKEMAAELEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLLGNPICSPDYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTAFSVQDPQLSKAVTINASASHSGLDDVNPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcgccctgctgctctgcgtcgccctggcgctcggccacgcagcaaatcct
tgctgttccaacccgtgtcaaaaccgaggtgtatgtatgagtgtgggatttgaccagtat
cagtgtgactgcacgcgcacaggattctatggtgaaaactgttcaacacctgaatttctg
acaaggataaaattattcctgaaacctactccaaacacagtacactacatacttacccac
ttcaagggagtctggaacattgtcaatagctttcccttcctgcgaaatgcagttatgaaa
tacgtgttagtatccagatcacatttgattgagagcccgccaacttacaatgcacagtat
ggctataagagctgggaatccttttccaacctctcgtattacaccagagctcttcctcct
gtggctgacggctgcccaacccccatgggtgtgaaagggaagaaagagcttcctgattca
aaagagattgtggaaaaatttctcctaagaagaaagttcatccctgacccccagggcaca
aatatgatgtttgcattttttgcccagcacttcacccatcagtttttcaagacagatcct
aagcgaggtccagctttcaccaaaggcctgggtcacggggtggatttaagtcatatttat
ggtgaaactttggatagacagcataaactgcgccttttcaaggacggaaaaatgaaatat
cagatcattaatggcgaggtgtatccgcccacagtcaaagacactcaggtggaaatgatc
tacccgcctcatattcctgagcacctgcggtttgctgtggggcaggaggtctttggtctg
gtgcctggcctgatgatgtatgccacgatttggctgcgggaacacaacagagtgtgtgat
gtcctcaaacaggagcatccagaatgggatgatgaacgcttgttccagacgagcaggctc
atactgataggagaaactatcaagatcgtgattgaagactatgtacagcacctgagcggc
tatcacttcaaactgaagtttgacccagagctgcttttcaaccaacagttccaataccaa
aaccgcattgccgctgagttcaacacgctctatcactggcatccccttctgcctgacacc
tttcaaatcgatgaccaggagtacaactttcaacagtttctctacaacaactctatctta
ctggaacatggactcacccagtttgttgaatctttcagcaggcaaattgctggcagggtg
gctggtggtaggaatgttccagctgcagcacagaaaatagcaaaggcctcaatcgaccag
agcagagagatgaagtaccagtctctgaatgagtaccgcaaacgctttcggctgacgccc
tataaatcatttgaagaacttacaggagagaaggaaatggctgcggagttagaagcactc
tatggtgacattgatgccatggagctgtatcctgcccttctggtggaaaagcctcgccca
gatgccatcttcggggagaccatggtagaacttggggcaccattctccttgaaaggactt
ttgggtaatcctatctgttctcctgactactggaaacccagcacttttggtggagaagta
ggttttaaaatcatcaacactgcctcaattcagtctctcatctgcaataacgtgaagggc
tgtccttttactgccttcagtgttcaggacccgcagctcagcaaagcagtcaccattaat
gccagcgcttcccactctggactagatgacgtgaatcccacagtactgctcaaagaacgt
tcaactgaactgtag

DBGET integrated database retrieval system