KEGG   Equus przewalskii (Przewalski's horse): 103547327Help
Entry
103547327         CDS       T04644                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00052  Galactose metabolism
epz00500  Starch and sucrose metabolism
epz01100  Metabolic pathways
epz04142  Lysosome
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103547327 (GAA)
   00500 Starch and sucrose metabolism
    103547327 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    103547327 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:epz04147]
    103547327 (GAA)
Enzymes [BR:epz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103547327 (GAA)
Exosome [BR:epz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103547327 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 103547327
NCBI-ProteinID: XP_008512683
LinkDB All DBs
Position
Un
AA seq 951 aa AA seqDB search
MDGRRLPCSRPLGLCVLVCLATAALLGHVLLHDFTMVPRELHGFSQVPKEIYRAPQQGAS
GPGPQPAPGRRGSPRAAPAQCDTPPDSRFDCAPDKAITQEQCEARGCCYVPARRQPPGSQ
MGQPWCFFPPSYPSYKLGNLTTTEMGYTATLTRAAPTFFPKDILTLRLDVLVETESRLHF
TIKDPANRRYEVPLETPRVRSRATSTLYSVEFSEEPFGVVVRRKLNGRVLLNTTVAPLFF
ADQFLQLSTSLPSRYVTGLAEHLGPLMLNTNWTKITLWNRDIAPTPSVNLYGSHPFYLVL
EDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYVFLGPEPKSVVQQYLEVVGYP
FMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDARRDFTFNKDGF
GDFPAMVQELHQGGRRYMMIVDPAISSSGPPGSYRPYDEGLRRGVFITNETGQPLIGKVW
PGSTAFPDFTNPEALDWWQDMVAEFHAQVPFDGMWIDMNEPSNFVKGSVDGCPDSDLENP
PYVPGVVGGTLRAATVCASSQQFLSTHYDLHNLYGLTEAIASHRALVKARGVRPFVISRS
TFAGHGRYAGHWTGDVWSSWEQLSYSVPEILLFNLLGVPLVGADICGFLGNTSEELCVRW
TQLGAFYPFMRNHNGLDSLPQEPYRFSETAQQAMRKAFALRYMLLPHLYTLFHGAHTRGQ
TVARPLFLEFPEDPRTWTVDRQLLWGEALLITPVLEAGRVEVTGYFPLGTWYDLQTVPVG
ALGGLPSPAPAPLMPAIHSEGQWVTLPAPLDTINLHLRAGHIIPLQGPSLTTTESRKQPM
ALVVALTSSREAQGELFWDDGESLGVLEREAYTHIIFLARNNTIINELLHVTSEGASLQL
ERVTVLGVAVAPQQVLSNGVPVSNFTYNPDTKTLDIPVSLTMGEQFLISWS
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atggatgggaggcggctgccctgctcccgccccctggggctctgcgtcctcgtctgcttg
gccaccgctgccctcctggggcatgtcctgctgcacgatttcacgatggtcccccgagag
ctgcatggcttctcccaagtacccaaggagatttaccgagctccccagcagggagccagc
ggcccagggccccaacccgccccagggcgccgcggcagtcccagagcagctccggcacag
tgcgacacgccccccgacagccgcttcgactgtgccccagacaaggccatcacccaggag
cagtgtgaggcccggggctgctgctacgtgcctgccaggcggcagcctccgggctcccag
atggggcagccctggtgcttcttcccccccagctacccgagttacaagctggggaacctg
accaccaccgagatgggctacaccgccaccctcactcgagccgccccgaccttcttcccc
aaggacatcctgaccttacggctggacgtgctcgtggagactgagagccgactccacttt
acgatcaaagaccccgccaacaggcgctacgaggtgcccctggagaccccgcgcgtccgc
agccgggcaacgtccactctctacagcgtggagttctcggaggagcccttcggggtggtc
gtgcgccggaagctgaacggacgggtgctgctgaacacgacggtggcccccctgttcttc
gccgaccagtttctgcagctgtccacctccctgccatcccggtacgtcaccggccttgcc
gagcaccttggccccctgatgctcaacaccaactggaccaagatcaccctctggaaccgg
gacatcgcccccacgccctccgtgaacctctacgggtcccatcctttctacctggtgctg
gaggacggcgggtcggctcacggggtcttcctcctgaacagcaatgccatggatgtggtc
ctgcagcctagcccggccctcagctggaggtcaactggcgggatcctggacgtgtacgtc
ttcctgggcccggagcccaagagcgtggtgcagcagtacctggaagtcgtgggctacccg
ttcatgccgccgtactggggcctgggtttccacctctgccgctggggctactcctccacc
gccatcacccgccaggtcgtggagaacatgaccagggcccacttccccctcgacgtccag
tggaacgacctggactacatggacgccaggagggacttcactttcaataaggacggcttc
ggggacttcccggccatggtgcaggagctccaccagggcggccggcggtacatgatgatc
gttgaccccgccatcagcagttctggcccccccgggagctaccgaccctatgacgagggt
ctgcggaggggggttttcatcaccaatgagactgggcagccgctgattgggaaggtatgg
cccgggtccaccgccttccccgacttcaccaaccctgaggcccttgactggtggcaggac
atggtggccgagttccacgcccaggtgccctttgacggcatgtggattgacatgaatgag
ccgtccaacttcgtaaagggctctgtggacggctgccccgacagcgacctggagaaccca
ccctatgtgccaggggtggttggcgggaccctccgggcagccaccgtctgtgcctccagc
cagcagttcctctccacgcactacgacctgcacaacctgtacggcctgaccgaagccatc
gcctcccacagggccctggtgaaggctcggggggtgcgccccttcgtgatttcccgctca
accttcgctggccacggccgatacgccggccactggacaggggatgtgtggagcagctgg
gagcagctctcctactctgtgccagaaatcctgctcttcaacctgctgggggtgccgctg
gtcggggccgacatctgtggcttcctgggcaacacctcagaggagctgtgtgtgcgctgg
acccagctgggggccttctaccccttcatgcggaaccacaacggcctggacagcctgcct
caggagccgtacaggttcagcgagacggcgcagcaagccatgaggaaggcctttgccctg
cgctacatgctgctgccccacctctacacactgttccacggggcacacaccaggggccag
actgtggcccggcccctcttcctggagttccctgaggacccccgcacctggaccgtggac
cgccagctcctgtggggggaggccctgctcatcaccccagtgctcgaggccgggagggtc
gaagtgactggctactttccgctcggcacgtggtacgacctgcagacggtgccagtaggg
gcccttggtggcctcccctctccagctcctgcacccctcatgcctgccatccacagtgaa
gggcagtgggtgacactgccagccccactggacaccatcaacctccaccttcgggctggg
cacatcatccccctgcagggacccagcctcacaaccacagagtcccgcaagcagcccatg
gccctggttgtggccctgacctcgagtcgggaggcccagggggagctgttctgggatgac
ggcgagagcctgggagtgctggagcgcgaggcctacacccacatcatcttcctggccagg
aacaacaccatcataaacgaactgttgcatgtgaccagtgagggggccagcctgcagctg
gagagggtgactgtcctgggggtggccgtggccccccagcaagtcctctccaatggtgtt
cctgtctccaacttcacctacaaccctgacaccaagaccctggacatccctgtctcgctg
accatgggagagcagtttctcatcagttggtcttaa

DBGET integrated database retrieval system