KEGG   Equus przewalskii (Przewalski's horse): 103549243Help
Entry
103549243         CDS       T04644                                 

Gene name
TGM2
Definition
(RefSeq) transglutaminase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:epz00001]
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    103549243 (TGM2)
Enzymes [BR:epz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     103549243 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core A2M_N
Motif
Other DBs
NCBI-GeneID: 103549243
NCBI-ProteinID: XP_008515659
LinkDB All DBs
Position
Un
AA seq 664 aa AA seqDB search
MSPVAIEDLVFLSLPFRVTLHFEGRNYEASVDSLTFSVVTGPAPSEEAGTKARFPLSDAV
DEGAWTALVVDQQDSALSLQLSTPANAPIGLYRLSLEASTGYEGSSFVLGHFTLLFNPWC
PADAVYLDSEQEREEYVLTQQGFIYQGSAKFIKGIPWNFGQFEDGILDICLMLLDINPKF
LRDASRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGRWDNNYGDGISPMFWIGSVDILRR
WKSCGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTNYNSAHDQNSNLLIEYFRNEFGEI
QKDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPTPQEKSEGTYCCGPVPVRAIKEGD
LSTKYDAPFVFAEVNADVVDWIRQEDGSLHKSVNRSLVVGLKISTKSVGRDEREDVTHNY
KYPEGSPEEREAFTRANHLNKLADKEETGIAMRIRVSQSMSMGSDFDVFAYITNNTAEDH
ACRLLLCARTVSYNGVLGPECGAKDLLNLSLEPFSEKSIPLRILYKKYCDCLTESNLIKV
RGLLIEPAANNYLLAERDIYLENPEIKSQILGEPKQNRKLVAEVSLRNPLAVPLLGCTFT
VEGAGLTEEQKTMEIPDPVEAGQEVKVRVDLLPLHVGRHKLVVNFESDKLKAVKGFRNVI
IGPS
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtctccagtagcgatagaagatctcgtgttcttgtcgttgcccttccgggtgacgttg
cacttcgagggccgaaactacgaggccagtgtggacagcctcaccttcagtgttgtgacg
ggcccagcccccagtgaggaggcagggaccaaggcccgcttcccgctgtccgacgctgtg
gacgagggtgcctggacggccttggtggtggaccagcaggacagcgccctctcgctgcag
ctcagcaccccagccaacgcccccatcggcctgtaccgcctcagcctggaggcctccact
ggctatgagggctccagcttcgtgctgggccatttcaccctgctcttcaacccctggtgc
ccagccgacgctgtgtacctggactcggagcaggagcgagaggagtacgtcctcacccag
cagggcttcatctaccagggctcggccaagttcatcaagggcataccctggaacttcggg
cagtttgaagatgggatcctggacatctgcctgatgctcctggacatcaaccccaagttc
ctgagggacgccagccgcgactgctcgcgccgcagcagccccgtctacgtgggccgggtg
gtgagcggcatggtcaactgcaacgatgaccagggcgtgctgctgggacgctgggacaac
aactacggggacggcatcagccccatgttctggatcggcagtgtggacatcctgcggcgc
tggaagagctgcggctgccagcgtgtcaagtatggccagtgctgggtcttcgcggctgtg
gcctgcacagtgctgcgctgcctcggcatccccacccgcgtcgtgaccaactataactct
gcccacgaccagaacagcaacctgctcatcgagtacttccgcaacgagtttggggagatc
cagaaggacaagagcgagatgatctggaacttccactgctgggtggagtcctggatgacc
aggccggacctgcagccagggtacgaggggtggcaggccctcgaccccacgccccaggag
aagagcgaagggacatactgctgcggcccagttccggtccgtgccatcaaggagggcgac
ctgagcaccaagtacgacgccccttttgtcttcgccgaggtcaatgccgacgtggtggac
tggatccggcaggaggatgggtccctgcacaagtccgtcaaccgctcgctggtggtgggg
ctgaagatcagcacaaagagcgtgggccgcgacgagcgggaagacgtcacccacaactac
aagtaccccgaggggtccccggaggagagggaagccttcacgagggccaaccatctgaac
aagctggctgacaaagaggagaccggcatcgccatgcgcatccgcgtgagccagagcatg
agcatgggcagtgacttcgacgtctttgcctacatcaccaacaacacggccgaagaccac
gcttgccgcctcctgctctgcgcccgcaccgtcagctacaacggggtcctggggcccgag
tgtggcgccaaggacctcctcaacctttccctggagcccttctctgagaagagcatccct
cttcgaatcctctataagaaatactgcgactgcctgaccgaatcgaacctcatcaaggtg
cgcggcctcctcatcgagcccgctgccaacaactaccttctggccgagagggacatctat
ttggagaacccagaaatcaagtcccagatcctgggggagcccaagcagaaccgcaagctg
gtggctgaggtgtccctgcggaacccgctggccgtgcccctgttgggctgcaccttcacc
gtggagggggcgggcctgaccgaggagcagaagaccatggagatcccggacccagtggag
gccgggcaggaagtgaaggtgagggtggacctgctgccgctgcacgtgggacgccacaag
ctggtggtgaacttcgagagcgacaagctgaaagctgtgaagggtttcaggaacgtcatc
atcggcccctcttaa

DBGET integrated database retrieval system