KEGG   Equus przewalskii (Przewalski's horse): 103549373Help
Entry
103549373         CDS       T04644                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00010  Glycolysis / Gluconeogenesis
epz00051  Fructose and mannose metabolism
epz00052  Galactose metabolism
epz00500  Starch and sucrose metabolism
epz00520  Amino sugar and nucleotide sugar metabolism
epz00524  Neomycin, kanamycin and gentamicin biosynthesis
epz01100  Metabolic pathways
epz01200  Carbon metabolism
epz04066  HIF-1 signaling pathway
epz04910  Insulin signaling pathway
epz04930  Type II diabetes mellitus
epz04973  Carbohydrate digestion and absorption
epz05230  Central carbon metabolism in cancer
Module
epz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
epz_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103549373 (HK1)
   00051 Fructose and mannose metabolism
    103549373 (HK1)
   00052 Galactose metabolism
    103549373 (HK1)
   00500 Starch and sucrose metabolism
    103549373 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    103549373 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103549373 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    103549373 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103549373 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103549373 (HK1)
 09160 Human Diseases
  09161 Cancers
   05230 Central carbon metabolism in cancer
    103549373 (HK1)
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    103549373 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:epz04131]
    103549373 (HK1)
Enzymes [BR:epz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103549373 (HK1)
Membrane trafficking [BR:epz04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103549373 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD UvrD-helicase
Motif
Other DBs
NCBI-GeneID: 103549373
NCBI-ProteinID: XP_008515895
LinkDB All DBs
Position
Un
AA seq 919 aa AA seqDB search
MGQTCQRGWDAACERPIRPPLTETKIDKYLYTMRLSDETLMDIMTRFKKEMKNGLSRDFN
PTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEQNQNVHMESEIYDTPE
NIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCRQSKIDEAILITWTKRFK
ASGVEGADVVKLLEKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNA
CYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKM
VSGMYMGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVTAIEKNKEGLHNAKEIL
TRLGVEPSDDDCIAVQHVCTIVSFRSANLVAATLGAILTRLRDNKGSPRLRTTVGVDGSL
YKTHPQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIKETLAH
FSLTKDMLLEVKRRMRAEMEMGLRKQTNDRAVVKMLPSFVRSTPDGTEHGDFLALDLGGT
NFRVLLVKIRSGKKRTVEMHNKIYAIPVEIMQGTGEELFDHIVSCISDFLDYMGIKGPRM
PLGFTFSFPCKQTSLDAGILVTWTKGFKATDCVGHDVATLLRDAVKRREEFDLDVVAVVN
DTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGSEGRMCINMEWGAFGDNG
CLDDIRTHYDRLVDEYSLNPGKQRFEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETL
KTRGIFQTKYLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGA
GMAAVVDKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPQCNVSFLLSEDG
SGKGAALITAVGVRLREDS
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgggacagacctgccagcgaggatgggatgcagcatgtgaaaggccaatccggcccccg
cttactgaaactaagattgacaagtatctctataccatgcggctctctgatgaaactctg
atggatatcatgactcgtttcaagaaggaaatgaagaatggcctctctcgggattttaat
ccgacagccacagtcaagatgttgccaacatttgtaaggtctattcctgatggttcagaa
aagggagatttcattgccctggatcttggtgggtcttcctttcgaattctgcgggttcaa
gtgaatcatgagcaaaaccagaatgtccacatggagtccgagatttatgacaccccggag
aacatcgtgcacggcagtggaagccagctttttgatcatgtcgccgagtgcctgggagac
ttcatggagaaaagaaaaatcaaggataagaaattacccgtgggattcacattttctttc
ccttgtcggcaatccaaaatagacgaggccatcctgatcacctggacaaagaggtttaaa
gcgagcggagtggagggagcggatgtggtgaagctgcttgaaaaagccatcaaaaagcgt
ggggattatgatgccaacattgtggctgtggtgaatgacacggtggggaccatgatgacc
tgtggctatgatgaccagcactgtgaagttgggctcatcattggcactggcaccaacgcg
tgctacatggaggaactgaggcacattgacctggtggaaggtgacgagggcaggatgtgc
atcaacacggagtggggggcctttggggacgacgggtccctagaagacatccgcactgag
ttcgaccgggagatagaccggggctccctcaaccctggcaaacagctgtttgagaagatg
gtcagtggcatgtacatgggggagctggttcgactgatcctggtcaagatggccaaggaa
ggcctcttatttgaagggcggatcactccagagctgctcaccagagggaagtttaacacc
agtgatgtgacagccattgaaaagaataaggaaggcctccacaatgccaaagaaatcctg
acccgcctgggagtggagccatctgatgacgactgtattgcagtccagcacgtgtgtacc
attgtctcatttcgctctgccaacctggtggctgcaacgctgggcgccatcttgactcgc
cttcgagataacaagggctcacccaggctgcggaccacggttggtgtcgacgggtctctt
tacaagacgcacccacagtattcccggcgtttccacaagactctgaggcgcttggtgccc
gactccgatgtacgtttcctcctctcggagagtggcagcggcaagggggccgccatggtg
accgcagtggcctatcgcctggctgagcagcaccgccagataaaggagaccctggcccac
ttcagcctcaccaaggatatgctgctggaggtgaagcggaggatgcgggctgagatggag
atggggctgaggaagcaaacgaacgaccgggctgtggtcaagatgctgccctccttcgtc
cgcagcactccagatgggaccgagcatggtgacttcttggccctggatcttggaggaacg
aatttccgtgtcctactggtgaaaatccgtagtgggaaaaagagaacggtggaaatgcac
aacaagatctatgccattcctgttgaaatcatgcagggcactggggaagagctgtttgac
cacatagtctcctgcatctctgacttcctggactacatggggatcaaaggtcccagaatg
cccctgggcttcacgttctcattcccctgcaagcagacgagcttggacgcgggaattttg
gtcacctggacgaagggttttaaggcaaccgactgcgtggggcatgatgtagcgacctta
ctaagggatgcggtcaaaaggagagaggaatttgacctggacgtggtggctgtggtcaac
gacacggtgggcaccatgatgacctgtgcttatgaagagcccacctgtgaggttggactc
atcgtagggactggcagcaatgcctgctacatggaagaaatgaagaacgtcgaaatggtg
gaaggaagtgaggggcggatgtgtatcaacatggagtggggtgcctttggggacaacggc
tgtctggacgatatcagaacacactatgacagactggtggatgaatattctctaaaccct
gggaaacaaaggtttgagaagatgatcagtgggatgtacctgggtgagattgtccgaaac
atcctgatcgacttcaccaagaagggattcctcttccgagggcagatctctgagacgctg
aagacgcggggcatctttcagaccaagtatctctctcagattgagagtgaccgattagca
ctgctccaggtccgggccattctccagcagctgggcctgaacagcacctgcgacgacagt
atccttgtcaagaccgtgtgtggggtggtgtccaagagggccgcgcagctgtgtggcgcg
ggcatggctgccgtggtggataagatccgtgagaacagagggctggaccatctcaacgtg
actgtcggggtggatggaacgctctacaagcttcatccgcacttctccagaatcatgcac
caaaccgtgaaggaactgtcaccacagtgtaacgtgtctttcctcctgtccgaagacggt
agtggcaagggggccgccctcatcacagcagtgggcgtacggctccgagaagacagctaa

DBGET integrated database retrieval system