KEGG   Equus przewalskii (Przewalski's horse): 103549794Help
Entry
103549794         CDS       T04644                                 

Gene name
GSTO2
Definition
(RefSeq) glutathione S-transferase omega 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00480  Glutathione metabolism
epz00980  Metabolism of xenobiotics by cytochrome P450
epz00982  Drug metabolism - cytochrome P450
epz00983  Drug metabolism - other enzymes
epz01100  Metabolic pathways
epz01524  Platinum drug resistance
epz05200  Pathways in cancer
epz05204  Chemical carcinogenesis
epz05225  Hepatocellular carcinoma
epz05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103549794 (GSTO2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    103549794 (GSTO2)
   00982 Drug metabolism - cytochrome P450
    103549794 (GSTO2)
   00983 Drug metabolism - other enzymes
    103549794 (GSTO2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103549794 (GSTO2)
   05204 Chemical carcinogenesis
    103549794 (GSTO2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103549794 (GSTO2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103549794 (GSTO2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103549794 (GSTO2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:epz02000]
    103549794 (GSTO2)
Enzymes [BR:epz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103549794 (GSTO2)
Transporters [BR:epz02000]
 Other Transporters
  Pores ion channels [TC:1]
   103549794 (GSTO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C_3 GST_C
Motif
Other DBs
NCBI-GeneID: 103549794
NCBI-ProteinID: XP_008516581
LinkDB All DBs
Position
Un
AA seq 251 aa AA seqDB search
MRRRLESMAEDATRALGKGSLPPGPVPEGLIRIYSMRFCPYSHRTRLILQAKGIRHEVIN
INLKNKPEWYYTKHPLGQIPVLENSKHQLIYESVIACEYLDDAYPGRKLYPFDPYERARQ
KMLLELFYKVPHLTKECLVAFRCGRECTDLKLALRQEFCNLEEILGYQNTVFFGGDCISM
IDYLFWPWFERLDVYGIADCVSHTPALRLWIAAMKQDPAVCALLIDKNIFLGFLNLYFQN
NPDAFDYGLSC
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagacgcctggagagcatggctgaggatgcgaccagagccttggggaaaggaagc
ctccccccagggccggtcccagagggcctgatccgcatctatagcatgcggttctgcccc
tactcgcacaggacgcgcctcatcctccaggccaaaggcatcagacatgaagttatcaac
attaacctgaaaaacaagcctgaatggtactacacaaagcatcctttgggccagattcct
gtcctggagaacagcaaacatcaactgatctacgagtctgtcatcgcctgtgagtacctg
gatgatgcttatcccggcaggaagctgtatcccttcgacccttatgagcgagctcgccaa
aagatgttattggagctgttctataaggtgccacatttgaccaaggagtgtctggtagcc
ttcagatgcgggagagaatgcaccgatctgaagctagccctgcgtcaagaattctgcaac
ctcgaagagattcttggctatcagaacaccgtcttctttggtggagactgtatatccatg
attgattacctcttttggccctggtttgagcggctggatgtatatggaatagctgactgt
gtgagccacaccccggcccttcggctctggatcgcagccatgaagcaggaccctgcagtg
tgtgctcttctcatagataagaacattttcctgggcttcttgaatctctattttcagaac
aaccccgacgcctttgactatgggctaagctgctga

DBGET integrated database retrieval system