KEGG   Equus przewalskii (Przewalski's horse): 103549941Help
Entry
103549941         CDS       T04644                                 

Gene name
GANC
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00052  Galactose metabolism
epz00500  Starch and sucrose metabolism
epz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103549941 (GANC)
   00500 Starch and sucrose metabolism
    103549941 (GANC)
Enzymes [BR:epz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103549941 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 103549941
NCBI-ProteinID: XP_008516818
LinkDB All DBs
Position
Un
AA seq 944 aa AA seqDB search
MVTNSHLRLGGLLSSLLALKGFGGQASISPPPVRPSYHPFVEDEAVDKNIFKDCSNIAFY
RRQKQQLSRKSMYRALLDSVTADRDSTRFQIINEATKAPLLAEVYGIEGNIFRLKINEET
PLKPRYEVPDVLTSKLSTVRLTSCSGDSGSLVLADGKGDLKCHITANPFKVDLVSEEEVV
MSINSLGQLYFEHLQIPLKQRATKENEEDASVDTSQENQEDLGLWEEKFGKFVDVKVNGP
ASIGLDFSLHGFEHLYGIPQHAESHQLKNTGDGDAYRLYNLDVYGYKIHDKMGIYGSVPY
LLAHKLGRTLGIFWLNASETLVEINTEPEVKYTLTQTGPAAAKQKVTSRTDVHWMSESGI
IDVFLLTGPTPSDVFKQYSRLTGTQALPPLFSLGYHQCRWNYEDEQDVKAVDAGFDEHDI
PYDVMWLDIEHTEGKRYFTWDKKRFPNPKRMQELLRSKKRKLVVISDPHIKVDLDYSVYA
KAKELGFFVRNHEGGDFEGVCWPGLSSYLDFTNPKVREWYSGLFAFSAYQGSTDILYIWN
DMNEPSVFRGPELTMQKNAIHHGNWEHRELHNIYGFYHQMATAEGLIQRSKGKERPFVLT
RSFFAGSQKYGAVWTGDNTAEWSYLKISIPMLLTLSVTGISFCGADVGGFIGNPDAELLV
RWYQAGAYQPFFRGHATMDTKRREPWLFGEEHTRLIREAIRQRYTLLPYWYSLFYRAHVA
SEPVMRPLWIEFPDALEAFGVEDEYMLGSALLVHPVTELEATVVDVFLPGSNEVWYDSKT
FTRWEGACTVKIPVDLDTIPVFQRGGSVVPIKTTIGKSTGCMTDSPYGLRVALSTKGSAV
GEFYLDDGHSFQYVHQKQFLHRKFSFCSGVLINSCADERGRYPSKCVVEQIFILGLKKKP
SSVTTHSSGGEDQPVAFVYCAKTSTLSLEKLSLDIGTDWEVHVK
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atggtcaccaatagccacctgcgccttggtgggctcctctcctctctgctagcccttaaa
gggtttgggggccaagcaagcatttctcctcctcccgttcgccccagctatcatcccttt
gttgaagatgaagctgtggataaaaacattttcaaagactgcagcaacattgctttctac
aggcgtcagaaacagcagctctccaggaagtccatgtatcgggcattactggactcggtc
acagcggacagagacagcactagattccaaatcatcaatgaagcgacgaaggctcctctc
ttggctgaagtttatggtatagagggaaatatcttcaggcttaaaatcaatgaagaaact
cccctgaaacccagatatgaagttcctgatgtcctcacaagcaagctaagcactgtaagg
ctgacttcatgctcaggggactcaggcagtctggtgttggcagatggcaaaggagatctg
aagtgtcatattacggcaaacccattcaaggtagacttggtgtctgaagaggaggtcgtg
atgagcataaactccttgggccaattgtactttgaacacctgcaaattcctctcaagcaa
agagctaccaaagaaaatgaggaggatgcatcagttgacacctctcaggaaaatcaagag
gatctgggcctgtgggaggagaaattcggaaaatttgtggatgtcaaagttaatggtcct
gcctccattggtttggatttctccttgcatggatttgagcatctctatgggatcccgcaa
catgcagaatcacaccaacttaaaaatactggtgatggggatgcttaccgtctttataac
ctggatgtctatggatataaaatacatgacaaaatgggcatttatggttcagtgccttat
ctcctggcccacaaactgggcaggactctaggcattttttggctgaatgcctcagaaaca
ctagtggagatcaatacagagcctgaagtaaagtacacactgacccagacgggcccagct
gctgccaaacaaaaggtcacatctcggaccgatgtgcactggatgtcagagagtggaatc
attgatgtttttctgctgacaggacctacaccatctgacgtcttcaagcagtactcgcgc
cttacaggcacacaagccttgccccctctcttctccttggggtaccatcagtgccgctgg
aactatgaagatgagcaggatgtaaaagcagttgatgcagggtttgatgaacatgacatt
ccttatgacgtcatgtggctggacatagagcacactgagggcaaaaggtacttcacttgg
gacaagaaaagattcccaaaccccaaaaggatgcaagagctgctcaggagcaaaaaacgt
aagcttgtggtcatcagtgacccccacatcaaggttgatcttgactactcagtgtatgcc
aaagctaaagaactgggcttcttcgtgaggaatcatgaagggggagactttgaaggggtg
tgctggcctggtctctcctcttacctggatttcaccaatcccaaagtcagagagtggtat
tcaggtctttttgctttctctgcttatcagggatctactgacatcctctacatatggaat
gacatgaatgaaccctctgtctttagagggccagagctaactatgcagaagaatgctatt
catcatggcaactgggagcacagagaactacacaacatctatggtttttatcatcaaatg
gctactgcagaaggactaatacaacgatcaaaagggaaggagagaccctttgttcttaca
cgttctttctttgctggatcacaaaagtatggtgctgtgtggacaggcgacaacacagca
gaatggagttacctgaaaatttctatccctatgttgctcactctcagtgtcactgggatc
tctttttgtggagctgatgtaggcggcttcatcgggaacccagacgcagagctgctagtg
cgttggtaccaggccggagcctaccagcccttcttccgtggccacgccactatggacacc
aagcgacgggaaccgtggctcttcggagaggaacacacccggctcatccgagaagccatc
agacagcgctacaccctcctaccctattggtattctctgttctaccgtgcacacgttgct
tctgaacccgtcatgaggcctctgtggatagagttccctgatgcattagaggcttttggt
gtggaagatgagtacatgctaggaagtgctttgttggttcatccagtcacagaactggaa
gccactgtagttgatgtgtttctgccaggatcaaatgaggtctggtatgactctaagaca
tttactcgttgggaaggagcatgtactgtgaagatcccagtagacttggacactatacca
gtgtttcaacgaggtggaagtgtagtgccaataaagacaactataggaaagtccacaggc
tgcatgactgattccccatatggactccgggtggctctaagcactaagggttctgccgtg
ggtgaattctatcttgatgatggccattcattccaatacgtccaccagaagcaattcttg
cacaggaagttttcattctgttcaggtgttttgatcaacagttgtgccgatgagagaggt
cgttatcccagcaagtgtgtggtggagcagatctttatcctaggcctcaagaagaagcca
tcttctgtgaccacccactcatctggtggtgaagaccagcctgtggcttttgtatattgt
gccaaaacatccaccttgagcctggagaagctctcactggacattggtactgactgggag
gtccacgtcaaatga

DBGET integrated database retrieval system