KEGG   Equus przewalskii (Przewalski's horse): 103551021Help
Entry
103551021         CDS       T04644                                 

Gene name
MGST2
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00480  Glutathione metabolism
epz00980  Metabolism of xenobiotics by cytochrome P450
epz00982  Drug metabolism - cytochrome P450
epz00983  Drug metabolism - other enzymes
epz01524  Platinum drug resistance
epz05200  Pathways in cancer
epz05204  Chemical carcinogenesis
epz05225  Hepatocellular carcinoma
epz05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:epz00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    103551021 (MGST2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    103551021 (MGST2)
   00982 Drug metabolism - cytochrome P450
    103551021 (MGST2)
   00983 Drug metabolism - other enzymes
    103551021 (MGST2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    103551021 (MGST2)
   05204 Chemical carcinogenesis
    103551021 (MGST2)
   05225 Hepatocellular carcinoma
    103551021 (MGST2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    103551021 (MGST2)
  Drug resistance
   01524 Platinum drug resistance
    103551021 (MGST2)
Enzymes [BR:epz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103551021 (MGST2)
Transporters [BR:epz02000]
 Other Transporters
  Pores ion channels [TC:1]
   103551021 (MGST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 103551021
NCBI-ProteinID: XP_008518496
LinkDB All DBs
Position
Un
AA seq 146 aa AA seqDB search
MAGNSILLAAVSLLSACQQSYFAFQVGRARLKYKIMPPAVSGSPEFDRIFRAQQNSVEFY
PAFMITLWMAGWYFNQVFATCLGLLYIYARHQYFWGYSEAANKRMTGFRLGLGILALLAI
LGALGIANSFLDEYLDLNVAKKLRHF
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggctgggaattcaatcttgctggctgctgtctctctcctctctgcctgtcagcaaagt
tattttgcttttcaagtaggaagggcaagattaaaatacaaaattatgcccccggcagtc
tctgggtcaccagaatttgacagaatatttcgtgcacaacaaaacagtgtggagttttac
cccgcattcatgattacattgtggatggctgggtggtatttcaaccaagtttttgctact
tgtctgggtctgttgtacatctatgcccgtcaccagtatttctggggatattcagaagct
gctaacaaaaggatgactggtttccggttgggtctggggattttggccttgttggccatc
ctgggcgccctggggattgcaaacagctttctggatgaatacctagacctcaatgttgcc
aagaaactgaggcacttctaa

DBGET integrated database retrieval system