KEGG   Equus przewalskii (Przewalski's horse): 103551124Help
Entry
103551124         CDS       T04644                                 

Gene name
FASN
Definition
(RefSeq) fatty acid synthase
  KO
K00665  fatty acid synthase, animal type [EC:2.3.1.85]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00061  Fatty acid biosynthesis
epz01100  Metabolic pathways
epz01212  Fatty acid metabolism
epz04152  AMPK signaling pathway
epz04910  Insulin signaling pathway
Module
epz_M00082  Fatty acid biosynthesis, initiation
epz_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    103551124 (FASN)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    103551124 (FASN)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103551124 (FASN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:epz01004]
    103551124 (FASN)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:epz04147]
    103551124 (FASN)
Enzymes [BR:epz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.85  fatty-acid synthase system
     103551124 (FASN)
Lipid biosynthesis proteins [BR:epz01004]
 Fatty acid synthase
  Animal type
   103551124 (FASN)
Exosome [BR:epz04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103551124 (FASN)
  Exosomal proteins of breast milk
   103551124 (FASN)
  Exosomal proteins of colorectal cancer cells
   103551124 (FASN)
  Exosomal proteins of bladder cancer cells
   103551124 (FASN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl_transf_1 ketoacyl-synt KR Thioesterase Ketoacyl-synt_C KAsynt_C_assoc PS-DH ADH_zinc_N_2 ADH_zinc_N PP-binding adh_short Thiolase_N Methyltransf_12 Methyltransf_31 Methyltransf_23 Methyltransf_11 ACP_syn_III
Motif
Other DBs
NCBI-GeneID: 103551124
NCBI-ProteinID: XP_008518675
LinkDB All DBs
Position
Un
AA seq 2450 aa AA seqDB search
MPSGGLGTALSLSLSEQLALTEPGGQLLQRMGGQCAEGWTQLSLLCDRAHHLALVGSACP
GVKCGQCRLPVALTERAAMEEVVIAGMSGRLPESENMQEFWANLIGGVDMVTDDDRRWKA
GLYGLPRRSGKLKDLSKFDASFFGVHPKQAHTMDPQLRLLLEVTYEAIVDGGINPALLRG
THTGVWVGVSGSEASEALSRDPETLLGYSMVGCQRAMMANRLSFFFDLKGPSITLDTACS
SSLLALHNAYQAIRSGECPAAIVGGINVLLKPNTSVQFMKLGMLSPEGACKSFDEAGNGY
CRSEAVVAVLLTKKSLARRVYATILNSGTNTDGSKEQGVTFPSGDAQEQLMSSLYKPAGV
APESLEYLEAHGTGTRVGDPQELKGVVRALCATRQDPLLIGSTKSNMGHPEPASGLAALA
KVLLSLEHGLWAPNLHFHSPNPEIPALRDGRLQVVDRPLPIRGGNVGINSFGFGGSNVHV
ILQPNSRLPLVPTPHVALPCLLRASGRTSEAVLGLLEQGRQHSQDLAFVSMLNDIAATPP
SAMPFRGYAVLGGEGDAQEVQQVSTGQRPLWFICSGMGAQWRGMGLSLMRLGTFRDSILR
SDKAVKPLGLQVSDLLLSADEATFDDTVPGFVSLTAIQIALIDLLTSMGLRPDGIIGHSL
GEVACGYADGCVSQEEAILAAYWRGQCIKEANIPPGAMAAVGLSWEECKQRCPPGVVPAC
HNSKDTVTISGPQAAVSEFVEQLKQEGVFAKEVRTGGLAFHSYFMDSISHTLLQALKKVI
REPRPRSVRWLSTSIPEAQWQSSLARTFSAEYNVNNLVSPVLFQEALCHVPEHAVVLEIA
PHALLQAVLKRGLKPSCTIVPLMKKDHRDNLEFFLSNVGRLHLMGIDVNPNGLFPPVEFP
APRGTPLISPHIKWDHSQTWYVPSAKDFPSGSSCSSSTVYNIDASPESPDHYLVDHCIDG
RTLFPATGYLCLVWRTLAHALGENLEQMPVVFEDVTLYQATILPKTGTMPLEVRLLEASH
TFEVSENGTLIVSGKVYQWDNPNPKLFDNRDSLDPADPTDPTATFHLAQGDVYKELRLRG
YDYGPHFQGILKANLEGNTGQLLWKDNWVTFLDTMLQMSILGSAQRSLRLPTRIAAIHID
PATHQQKVYTLQGEAQVADLVVDSCLSSTVAGGAIISRLHTSLAPRRQQEQLAPTLEKFC
FTPHVEGGCLAGSATLQEELQLCKGLAQALQVKVAQQGLKMVVPGLDGAQVPRESPQQGL
PRLLAAACQLQLNGNLQLELGQVLAQESPLLCDDPLLSGLLDSPALKACVDTALENVASL
RMKVVEVLAGDGHLYSRIPALLTTQPMLQLDYTATDRHAQALKAAQAKLQQHHVAQGQWD
PMXXXXXXXXXXLLVCNCAVATLGDPATALGNMAAVLKEGGFLLLHTLLRGYPLGEMVAF
LTCPEPQRGRQGLLSQDEWESLFAGASLRLVALKKSFYGSVLFLCRRPAPQDSPIFLPVE
DMSFRWVDSLKNILADLSSRPVWLTAVSCSTSGVIGMANCLRKEPGGHRIRCILVSNLSN
TSPVPKMDPSSSELQKVLQGDLVMNVYRDGAWGTFRHFPLEQDQPEEQTEHAFINVLTRG
DLSSIRWVCSPLRHAQHPGPGLQLCTVYYASLNFRDIMLATGKLSPDAIPGKWAARDCML
GMEFSGRDASGKRVMGLVPAEGLATSVLLSQDFLWDVPSCWTLEEAASVPVVYTTAYYSL
VVRGRVRRGETVLIHSGSGGVGQAAIAIALSLGCRVFTTVGSAEKRAYLQARFPQLNDTS
FANSRDTSFEQHVLRHTAGKGVDLVLNSLAEEKLQASVRCLAQHGRFLEIGKFDLSNNHP
LGMAVFLKNVTFHGILLDALFDETSSDWQEVVALVRAGIQDGVVQPLKCTVFPKTQVEDA
FRYMAQGKHIGKVVVQVREEEPEAVLQEVKPTRMVALSKTFFPAHKSYVVVGGLGGFGLE
LAQWLVLRGAQKLVLTSRSGIRTGYQAKQVREWRHQGVQVLVSTCNASSLDGARGLIAEA
AQLGPVGGVFNLAMVLRDAMLENQTPELFQDVNKPKYNGTLNLGRVTRETCPELDYFVAF
SSVSCGRGNAGQTNYGFANSTMERICEKRRHDGLPGLAVQWGAIGDVGIILEAMGANDTV
IGGTLPQRIASCLEVLDLFLNQPHPVLSSFVLAEKKAAAHSDSSSQQDLVKAVAHILGIQ
DLATINLDSSLVDLGLDSLMGVEVRQTLEREHDMVLSMRDIQQLTLRKLQELSSQTCMAD
ELAAPTPKEDGLTRQQAQLNLSTLLVNPEAPTLTRLNSVQSSERPLFLVHPIEGSITVFH
SLATKLSIPTYGLQCTKAAPLDSIQSLAAYYIECIRQVQPEGPYRIAGYSYGACVAFEMC
SQLQAQQSSAPAHNSLFLFDGSHAYVLAYTQKDTNPVGLGPHPYDLIEPL
NT seq 7353 nt NT seq  +upstreamnt  +downstreamnt
atgccctcaggtggtctgggcactgctctgagcctttccctgtctgagcagctggctctc
actgaaccaggtggacagcttctccagaggatgggaggacagtgcgcagaaggctggacc
cagctctccctgctgtgtgaccgggctcatcacttggcccttgtaggctcagcttgccct
ggtgtaaaatgtggacagtgtcgtctccctgtcgcgctcacagagagagcagccatggag
gaggtggtgattgccggcatgtctgggaggctgcccgagtcagagaacatgcaggagttc
tgggctaatctcatcggtggcgtggacatggtgacggatgatgacaggcggtggaaggcc
ggactctacggcctgcccaggcggtctggcaagctgaaggacctgtccaagtttgacgcc
tccttttttggggtccaccccaagcaggcacacactatggatccccagctacgcttgctg
ctggaggtcacctacgaggccatcgtggatggaggcatcaacccggccttgctgcgaggg
acacacactggcgtctgggtgggtgtgagcggctcagaggcgtcagaggctctgagccga
gaccccgagacgctgctgggctacagcatggtgggctgccagcgtgccatgatggccaac
cgcctctccttcttcttcgaccttaaagggcccagcatcactctggacacagcctgttcc
tccagcctgctggccctgcacaatgcctaccaggccatccgcagtggggaatgccccgcg
gccatcgtgggtggcatcaacgtcctgctgaagcccaacacctccgtgcaattcatgaag
ctgggcatgctcagccccgagggcgcctgcaagtcctttgacgaggctggaaatggctac
tgccgctcagaggctgtggtggctgtcctgctgaccaagaagtcccttgctaggcgagta
tacgccaccatcctgaattcaggcaccaacacggacggcagcaaggagcaaggtgtgacc
ttcccctccggagacgcgcaagagcagctcatgagctccctgtataagccggctggggtg
gcccccgagtccctcgagtacctcgaagctcacggcacaggcactagggtgggtgacccc
caggagctgaagggtgtcgtccgagccctgtgcgccacccgccaggatcccctgctgatc
gggtccaccaagtcgaacatgggacacccagagcccgcctcggggcttgcagcgctggcc
aaggtgctgctgtccctggagcacgggctctgggcccccaacctgcacttccacagccca
aaccctgagatcccagcactgcgggacggtcggctgcaggtagtagaccggcccctgccc
atccgagggggcaacgtgggcatcaactccttcggctttggcggctccaacgtgcacgtc
atcctccagcccaactcacggctgcccctggtgcccaccccgcatgtggctctgccctgt
ctgctgcgggccagcgggcgcacctccgaggccgtgcttggcctgctggagcagggccgc
cagcacagccaggacctggccttcgtgagcatgctcaatgacatcgccgccacccccccc
tccgccatgcccttccggggctatgccgtgctgggtggcgagggtgatgcccaggaggtg
cagcaggtgtccactggtcagcgcccactctggttcatctgctccgggatgggcgcgcag
tggcgtggaatggggctgagtctcatgcgcctgggcaccttccgcgactccatcctgcgc
tccgacaaggctgtgaagcccctgggactgcaggtgtcagacctactgctgagcgcagat
gaggccaccttcgacgacactgttcctggcttcgtgagccttactgccatccagatcgcc
cttatagacctgctgacttccatgggcctgagacctgacggcatcatcgggcactccctg
ggcgaggtggcctgcggctacgccgatggctgcgtctctcaggaggaggccatcctcgct
gcctactggaggggccagtgcatcaaggaggccaacatcccgccaggggccatggcggcc
gtgggcttgtcctgggaggagtgtaagcagcgctgcccgcccggcgtcgtgcccgcttgc
cacaactccaaggacacggtgaccatctcgggaccacaggctgccgtgtctgagttcgtg
gagcagctgaagcaggagggcgtgtttgccaaggaggtgcggactggcggcctggccttc
cactcttacttcatggactccatcagccacaccctgctgcaggcactcaagaaggtgatc
cgggagccgcggccccgctcggtgcgctggctcagcacctccatccccgaggcccagtgg
cagagcagcctggcccgcaccttctccgctgagtacaatgtcaacaacctggtcagccca
gtgctgttccaggaagcgctgtgtcatgtgcctgagcacgctgtggtgctggagatcgct
ccccacgccctgctgcaggccgtgctaaagagaggcctcaagcccagctgcaccattgtc
cccctgatgaagaaggaccacagggacaacctggagttcttcctcagcaacgtgggcaga
ctccacctgatgggcatcgacgtcaaccccaacggcctgttcccacccgtggagttcccg
gctccccgggggaccccactcatctccccacacatcaaatgggaccacagccagacctgg
tatgtgccctctgccaaggacttccctagtgggtccagctgctcctcctccaccgtctac
aacattgacgccagccccgagtcccccgaccactacctggtggaccactgcattgacggc
cgcactctcttccctgccactggctacctgtgtctggtctggaggacactggctcatgcc
ctgggcgagaacctggagcagatgccagtggtgtttgaggatgtgacgctgtaccaggcc
accatcctgcccaagacagggaccatgcccctggaggtacggcttctggaggcctcccac
acattcgaggtgtctgagaatggcaccctgatagtgagcgggaaggtgtaccagtgggac
aaccccaaccccaagctcttcgacaaccgagatagcctggaccctgcagaccccactgac
cccacagccacgttccacctggcccagggggacgtgtacaaggagctgcggctgcgtggc
tatgactacggccctcacttccagggcatcctcaaggccaacctcgaaggcaacacaggc
cagctgctgtggaaggacaactgggtgacgttcttggacaccatgctgcagatgtccatc
cttggctcagcccagcgcagcctgcgcctgcccacgcgcattgccgccatccacatcgac
cccgccacccaccagcagaaggtgtacacgctgcagggcgaggcccaagtggctgacttg
gtggtggacagctgtctgagcagcacagtggctgggggtgccatcatctctcggctccat
acctcactggccccacggcggcagcaggaacagctcgcacccaccctggagaagttttgc
ttcacgccgcacgtggaggggggctgcctagctgggagcgccaccctgcaggaggagctg
cagctgtgcaaggggctggctcaggcgctgcaggtcaaggtggcccagcagggcctcaag
atggtggtgccagggttggacggggcacaggtcccccgggagtccccacagcagggcctg
cctcgactgctggcagctgcctgccagttacagctcaatgggaacctgcagctggagctg
ggccaggtgctagcccaggagagccccctgctgtgtgacgaccccctgctcagcgggctc
ctcgactccccagcgctcaaagcctgcgtggacactgccttggagaacgtggccagcctc
aggatgaaggtggtggaggtgttggctggtgatggccacctgtattcccgcatcccggcg
ttgcttaccacccagcccatgctgcagctggactacacagccactgaccgccacgcccag
gccctgaaggctgcccaggccaagctgcagcagcaccacgtggcccagggccagtgggac
cccatgnngnnnnnnnnnnnnnnnnnnnnnnnnnncctcctggtgtgcaactgcgctgtg
gccaccctcggcgacccagccacggccctcgggaacatggcggctgtcctcaaggagggc
ggcttcctgctgctgcacacccttctcagaggatacccccttggagagatggtcgccttc
cttacctgccccgagccccagagaggcaggcagggcctcctgagccaggacgagtgggag
agcctgtttgctggggcatccctgcgcctagtggccctgaagaagtccttctatggctct
gtcctcttcctgtgccgccggccagccccacaggacagccccatcttcctgcctgtggag
gacatgagcttccgatgggtggactcactgaagaacattctggccgacttgtcctctcgg
cccgtgtggctgacggccgtcagctgcagcacctcaggcgtcataggcatggccaactgt
ctccgcaaagagcctggcgggcaccggattcggtgcatcctggtgtccaacctcagcaac
acgtcccccgtccccaagatggacccgagctcctcagagctgcagaaggtgctacagggg
gacctggtgatgaatgtctaccgagatggggcctgggggaccttccgccacttcccactg
gagcaagaccagccagaggagcagacagagcatgccttcatcaatgtcctcacccgcggg
gacctctcctctatccgctgggtctgctccccgctgcgccacgcccagcacccgggtccc
ggcctccagctctgcaccgtgtactatgcctccctcaacttccgagacatcatgctggcc
acgggcaagctgtcgcctgatgccatcccagggaagtgggccgcccgggactgcatgctg
ggcatggagttctctggccgagatgccagtgggaagcgtgtgatggggctggtgcccgct
gaaggcctggccacctccgtcctgctgtctcaggacttcctgtgggacgtgccttcctgc
tggaccctggaggaggcagcttccgtgcccgttgtctataccactgcctactactcgctg
gtggtgcgcgggcgtgtgcggcgtggggagacggtgctcatccactccggctcagggggc
gtgggccaggctgccattgccattgctcttagcctgggctgccgtgtcttcaccaccgtg
gggtcagctgagaagcgggcgtacctccaggccaggttcccccagctcaacgacaccagc
tttgccaactcccgggacacgtcctttgagcagcatgtgctgcggcacacagctgggaag
ggtgttgacctggtcctgaactccctggcggaagagaagctgcaggccagcgtgcggtgc
ctggcccagcatggccgcttcctggaaatcggcaaattcgatctgtccaacaaccacccc
ctgggcatggccgtttttctgaaaaatgtgaccttccatgggatcctgttggatgcgctc
ttcgatgaaactagctccgactggcaggaggtggtggcactggtgcgggcgggcatccag
gacggcgtggtgcagcccctcaagtgcactgtattccccaagacccaagtggaggacgcc
ttccgctacatggcccaggggaagcacattggcaaagtggtcgtccaggtgcgtgaggag
gagccggaggcggtgctgcaggaggtgaagcccacccggatggtggctctgtccaagacc
ttcttcccagcccacaagagctatgtcgtcgtggggggcctgggcgggtttggccttgag
ctggcccagtggctggtgctgcgaggggcccagaagctggtgctgacctcccgctcaggg
atccgcacgggctaccaggccaagcaggtccgtgagtggaggcaccagggtgtgcaggtc
ctagtatccacctgcaatgccagctcgctggatggggcccggggcctcattgccgaggcc
gcacagcttgggcctgtgggaggcgtcttcaacctggccatggtcctgagagatgccatg
ctggagaaccagacccctgagctcttccaggacgtcaacaagcccaagtacaacggcacc
ctgaatctgggcagggtgacccgagagacatgccccgagctcgactactttgtcgccttc
tcctcggtgagctgcgggcgcggcaacgccggccagaccaactacggcttcgccaactcc
accatggagcgcatatgcgagaagcgcaggcatgacggcctcccaggcctcgccgtgcag
tggggcgccattggtgatgtgggcatcatcctggaggcgatgggcgccaacgacacggtc
atcggtgggacactgccacagcgcattgcctcctgcctcgaggtgctggatcttttcttg
aaccagccacatcccgtcctgagcagctttgtgctagccgagaagaaggctgcagcccac
agtgacagcagcagccagcaggacctggtgaaggccgtggctcacatcctgggcatccaa
gacttggccaccatcaacttggacagctcactggtggacctgggcctggactcactcatg
ggcgtagaggtgcgccagacactggagcgcgagcatgacatggtgctgtccatgcgggac
atccagcagctcactctccggaagctgcaggagctttcttcacagacctgcatggctgat
gagctggcagcccccacacccaaggaagacggcctcaccaggcagcaggcccagctgaac
ctgagcaccctcctggtaaaccctgaggccccgaccttgacgcggctcaactcagtgcag
agttccgagcggcccctgttcctggtgcaccccattgagggctccatcactgtgttccac
agcctggccaccaagctcagcatccccacctacggcctacagtgcaccaaagctgctccc
ctggatagcatccagagcctggctgcctactacattgagtgcatcaggcaggtgcagccc
gaggggccctaccgcatcgccggctactcctacggggcctgcgtggcctttgagatgtgc
tcacagctgcaggcacagcagagctcggcccccgcacacaacagcctcttcctgttcgac
ggctcgcacgcctatgtcctggcgtacacgcagaaggacaccaatcctgttggattaggg
ccccacccttatgacctcatcgaacctttatga

DBGET integrated database retrieval system