KEGG   Equus przewalskii (Przewalski's horse): 103552092
Entry
103552092         CDS       T04644                                 

Gene name
CACNA1E
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04010  MAPK signaling pathway
epz04020  Calcium signaling pathway
epz04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103552092 (CACNA1E)
   04020 Calcium signaling pathway
    103552092 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103552092 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:epz04040]
    103552092 (CACNA1E)
Ion channels [BR:epz04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103552092 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 103552092
NCBI-ProteinID: XP_008520114
LinkDB
Position
Un
AA seq 2224 aa
MTIGSRLPGEITLGEATSSSLWGKKVSLLQFLSSALEDRAKSSVRDSAAHSPSFSDETVE
VWVGKDGEDLGSLPSSRDSFILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVL
KSIMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACFMNNSGILEGFDPPHPCGVQ
GCPAGYECRDWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYF
IPLIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAE
EVMLAEENKNAGTSALEVLRRATIKRSRTEAMTRDSSDEHCVDISSVGTPLARASIKSAK
VDGASYFRHKERLLRISIRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPQWLTHLLYYA
EFLFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGTSFGISVL
RALRLLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNF
NDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGN
YTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERDRR
RRHHMSMWEPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQEALNKEEAPPMNPLNPL
NPLSPLNPLNAHPSLYRRSRPIEGLALGLGLEKCEEERISRGGSLKGDGGDLSSALDNQR
SPLSLGKREPPWLSRPCHGNCDPTQQEAGGGETVVTFEDRARHRQSQRRSRHRRVRTEGK
EPTSTSRSRSASQERSLDEGVSTEGEKDCEPRGSHGVKEPTIQEEERARDLRRTNSLMVS
RGSGLAGALDETNTPLVLPQPELEVGKDAALTEQEPEGSSEQALLGDVHLDMGRAISQSE
PDLSCSTANTDKAATESTSVTVAIPDVGPLVDSTVVHISNKTDGEASPLKEAEIKEEEEE
EVEKKQQKKEKRETGKAMVPHSSMFIFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIA
LAAEDPVLTNSERNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFVV
VVGALVAFALANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNV
FNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWK
RHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVV
FPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQY
RVWHFVVSPSFEYTIMAMIALNTIVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKI
IAFGFLNYFRDTWNIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQ
GYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIRLDEESHINRHNNFRSF
FGSLMLLFRSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYVYFVSFIFF
CSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIPYKDMYKLVR
VISPPLGLGENCPYRVACKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQ
QLDAELQKETLAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKAKKQRQQ
LEEQKNAPMFQRMEPSSLPQEIIANAKALPYLQQDPVSGLSGHSGYPSMSPLSPQEIFQL
ACMDPADDGQFQEQQSLEPEVSEFKSVQPSNHGIYLPSDTQEHAGSGRASSMPRLTVDPQ
VVTDPSSMRRSFSTIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDS
GHKSDTHRSGGRERGRSKERKHLLSPDVSRCNSEERGTQADWESPERRQSRSPSEGRSQT
PNRQGTGSLSESSIPSVSDTSTPRRSRRQLPPVPPKPRPLLSYSSLIRHTGSISPPADGS
EGGSPLASQALESNDAILTESSNSRHAQQGPHSSPQRYISEPYLALHEDSHASDCGEEET
LTFEAAVATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRRGGPGPGVMCGAVSDLLSDTEE
DDKC
NT seq 6675 nt   +upstreamnt  +downstreamnt
atgaccataggatctcgcttaccgggggagattactctaggggaggcaaccagcagcagc
ctgtggggcaagaaggtgtcattacttcagtttctctcttcggccttggaagatagagcc
aaaagcagtgtcagagactctgctgcccatagcccctccttttcagatgagactgtggaa
gtttgggttgggaaagatggagaagacttgggaagcttgcccagctcccgagattcgttc
atcctggccaccgcgggaacccacttcaatacacacgtggacctgaggaccctccgggcc
gtgcgtgtcctgaggcccctgaagctcgtgtcaggcattcctagcctgcagattgtgttg
aagtccatcatgaaggccatggtgcctcttctgcagattggccttctgctcttctttgcc
atcctgatgtttgctatcattggcttggagttctacagtgggaagttgcaccgagcatgc
ttcatgaacaattcaggtattctagaaggatttgacccccctcacccatgtggcgtgcag
ggctgcccagctggttatgaatgcagggactggattggccccaacgatgggatcacccaa
tttgataacatcctttttgctgtgctgactgtcttccagtgcatcaccatggaagggtgg
accaccgtgctgtacaataccaatgatgccttaggagccacctggaattggctgtacttc
atccccctcatcatcattggatccttctttgttctcaacctagtcctgggagtgctttcc
ggggaatttgccaaagagagagagagagtggagaaccggagagctttcatgaaactgcgg
cgccagcagcagattgagcgcgagctgaacgggtaccgcgcctggatagacaaagcagag
gaagtcatgcttgctgaagaaaataaaaatgctgggacgtcagccttagaagtgcttcga
agggcaacaatcaaaaggagcagaacggaggctatgactcgagactccagcgacgagcac
tgtgtcgatatctcctctgtgggcacacctcttgcccgagccagcatcaagagtgccaaa
gtggacggggcctcctatttccggcacaaggaaaggcttctgcgcatttctatccgccac
atggttaaatcccaggtgttttactggattgtgctgagccttgtggctctcaacaccgcc
tgtgtggccatcgtccatcataaccagccccagtggctcacccacctcctctactatgca
gaatttttgtttctggggctcttcctcttggagatgtctctgaagatgtacggcatgggg
ccccgcctttattttcactcttcattcaactgctttgattttggggtcacagtgggcagt
atcttcgaagtggtctgggcaatcttcagacctggtacatcttttggaatcagtgtctta
cgagctctccggcttctaagaatatttaaaataaccaagtactgggcatccctgcggaat
ttggtggtctccttgatgagttccatgaagtcgatcatcagtttgctcttcctcctcttc
ctcttcatcgttgtctttgctcttctaggaatgcagctgtttggaggcaggtttaatttt
aatgatgggactccttcagcaaactttgacaccttcccagcagccatcatgactgtattc
cagatcctgactggtgaggactggaatgaggtgatgtacaatgggatccgctcccagggt
ggagtcagctcaggcatgtggtcggctatctacttcattgtgctcaccttgtttggaaac
tacacgctgctgaacgtgttcttggccattgctgttgacaatctggccaatgcccaggag
ctgaccaaggatgagcaggaagaagaggaggccttcaaccagaaacatgcactgcagaag
gccaaggaggtcagcccgatgtccgcacccaacatgccatctatcgaaagagacagaagg
agaagacaccacatgtcgatgtgggagccacgcagcagccacctgagggagcggaggcgc
cgacaccacatgtcggtgtgggagcagcgcaccagccagctgagaaggcacatgcagatg
tccagccaggaggctctcaataaagaggaggccccgccaatgaaccccctcaaccctctc
aacccactgagccccctcaacccactcaacgcccaccccagcctctaccggagatcaagg
cccattgagggcctggccctgggcctgggcctggagaagtgcgaggaggaacgcatcagc
cgtggcggatccctcaagggggacggaggggatctctcaagtgccctggacaatcagagg
agccccttgtctctgggcaaacgggaaccgccgtggctgtccaggccctgtcatgggaac
tgtgacccgacccagcaggaggctgggggaggggagaccgtggtgaccttcgaggaccgg
gccaggcaccggcagagccagcggcgcagccggcaccgccgcgtgcggacagaaggcaag
gagcccacctcaacctcccggagcaggtctgccagccaggagcggagtctggatgaaggg
gtgtctaccgagggggagaaggactgtgagcccaggggcagccatggggtcaaggaaccc
acaatccaggaagaagagcgagcccgggatttaaggaggactaacagtctgatggtgtcc
agaggctctgggctggcaggagccctcgatgagaccaacacacccctagtcctgccccaa
cccgagctggaagtggggaaggatgcagcgctgacagagcaggagccggagggcagcagt
gagcaagccctgctgggggacgtgcatctggacatgggccgggccatcagccagagtgag
cctgacctctcctgctccacagccaacacagataaggccgccactgagagcaccagcgtc
actgttgccatccctgacgtgggccccttggtggactctacagtggtgcacattagcaac
aagacggatggagaagccagtcccctgaaggaggcggagatcaaagaggaggaggaggag
gaggtggagaagaagcagcagaagaaggagaagcgtgagacgggcaaagccatggtgccc
cacagctctatgttcatcttcagcaccaccaacccgattcgcagggcctgccactacatc
gtgaacctgcgctactttgagatgtgcattctcctggtcatcgcagccagcagcattgcc
ctggcggccgaggaccctgtcctgaccaactcggagcgcaacaaagtcctgaggtatttt
gactatgttttcactggcgtgttcaccttcgagatggttataaagatgatagaccagggc
ttgatcctgcaggatgggtcctacttccgagacctgtggaacatcctagactttgtggtg
gtggttggcgcattggtggcctttgctttggcgaacgctttgggaaccaacaaggggcgg
gacatcaagaccatcaagtctttgcgggtgctccgagttctgaggccactgaagaccatc
aagcgcttgcccaagcttaaggctgtgttcgactgtgtggtgacctccttgaaaaacgtc
ttcaacatcctcatcgtctacaagctcttcatgttcatctttgctgtcatcgcagttcag
cttttcaagggaaagttcttttattgcacggacagttccaaggacaccgagaaagagtgc
ataggcaactatgtagatcatgagaaaaacaagatggaggtcaaaggccgagaatggaag
cgccatgagttccactatgacaacattatctgggccctgctgaccctcttcactgtctcc
acgggggaaggatggcctcaagttttgcaacattctgttgatgtgacagaggaagaccga
ggcccaagccgcagcaaccgcatggagatgtccatcttttacgtggtctattttgtagtc
ttccctttcttctttgtcaatatctttgtggctctcattatcatcaccttccaggagcaa
ggtgacaagatgatggaggagtgcagcctggagaagaatgagagggcatgtatcgacttc
gccatcagtgccaaacccctcacccgctacatgccgcagaacaggcacaccttccagtac
cgtgtctggcactttgtggtgtccccatcctttgagtacaccatcatggccatgatcgcc
ttgaacaccatcgtgctgatgatgaagtactactctgctccctgtacctatgaactggcc
ctgaagtacctgaacatcgccttcaccatggtgttttccctggaatgtgtcctaaagatc
attgcgtttggcttcttgaactatttccgagacacctggaatatctttgacttcatcacc
gtgatcggaagcatcacagaaattattctgacagacagcaagctggtgaacaccagtggc
ttcaatatgagctttctgaagctcttccgagccgcccgcctcatcaagcttctgcgtcag
ggctacaccatccgtattttactttggaccttcgtccagtcctttaaggccctgccctac
gtctgccttttgattgccatgcttttcttcatctacgccatcattgggatgcaggtattt
ggaaacataagattagatgaggagagtcacatcaaccggcacaacaacttccggagtttc
tttgggtcgctcatgttactcttcaggagtgccacaggtgaggcctggcaggagatcatg
ctgtcgtgcctcggggagaaaggctgtgagccggacaccaccgcaccctcagggcagaac
gagaatgagcgttgcggcactgatcttgcctacgtttactttgtctctttcatcttcttc
tgctccttcttgatgctcaacctgtttgtggctgtcatcatggacaactttgagtacctg
actcgggattcgtctatcctggggcctcaccacttggacgagtttgtccgtgtctgggca
gaatatgacagagctgcatgcggcaggatcccgtataaggatatgtacaaattagtgcgg
gtgatctcgccgcctctgggcctgggagaaaactgcccctacagggtggcctgcaagagg
ttggtcctgatgaacatgccagtggctgaagacatgacagtccacttcacctccacactt
atggctctgatccggacagctctggatatcaaaattgccaaaggtggtgcagacaggcag
cagctagacgcagagctacaaaaggaaaccctggccatttggcctcacctgtcccagaag
atgctggatctgctggtgcccatgcccaaagcctctgacctgactgtgggcaaaatctat
gcagcaatgatgatcatggactactataaacagagtaaggcgaagaagcaaaggcagcag
ctggaggaacagaaaaacgcacccatgttccagcgcatggagccctcatctctgcctcag
gagatcatcgctaatgccaaagccctgccttatctccagcaggaccccgtctcaggcctg
agtggccatagtggatacccttcgatgagtccactctccccccaggaaatattccagttg
gcttgtatggacccagcagatgacggacagttccaggaacagcagtctctggagccagag
gttagtgaatttaaaagcgtgcagccctctaaccatggcatctaccttccttcggacacc
caggagcatgcgggatctgggagggcatcctctatgccacgcctgactgtggatccccag
gtggtgacagatcccagctccatgagacgatcattttccactattcgggataagcgttcc
aattcctcatggttggaggaattctccatggaacgaagcagtgaaaacacctacaagtca
cgtcgccggagttaccactcctccctcaggctgtcagcccatcgcctgaactctgactca
ggccacaagtccgacacccaccgctcagggggcagagagcggggacgatcgaaagagcga
aagcatcttctctctcctgatgtctcccgctgcaactcagaggagcgagggacccaggct
gactgggagtccccagagcgtcgtcagtccaggtctcccagtgagggcaggtcacagacc
cccaacagacagggcacaggctccctgagtgaaagctccatcccctccgtctctgacacc
agcaccccaagacggagtcgtcggcagctcccaccagtccctcctaagcctcggcccctc
ctctcctacagctccctgatacgacacaccgggagcatctcgccacccgctgatgggagt
gagggtggctccccactggcctcccaagctctggagagcaacgacgctatcctgaccgag
tcttccaactcccggcacgcacagcagggcccacactcctccccacagcgctacatctcc
gagccctacctggccctgcacgaagactcccatgcctcggactgtggcgaggaggagacg
ctcacctttgaagcagctgtggctaccagcctgggccgttccaacaccatcggctcagcc
ccgcccctgcggcacagctggcagatgcccaatgggcactatcggcggcggaggcgtggg
gggcctgggccaggcgtgatgtgtggagctgtcagcgacctcctgagcgacacggaagaa
gacgacaaatgctag

DBGET integrated database retrieval system