KEGG   Equus przewalskii (Przewalski's horse): 103552097Help
Entry
103552097         CDS       T04644                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04110  Cell cycle
epz04213  Longevity regulating pathway - multiple species
epz04330  Notch signaling pathway
epz04919  Thyroid hormone signaling pathway
epz05016  Huntington's disease
epz05034  Alcoholism
epz05165  Human papillomavirus infection
epz05169  Epstein-Barr virus infection
epz05200  Pathways in cancer
epz05202  Transcriptional misregulation in cancer
epz05203  Viral carcinogenesis
epz05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:epz00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    103552097 (HDAC1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    103552097 (HDAC1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    103552097 (HDAC1)
  Aging
   04213 Longevity regulating pathway - multiple species
    103552097 (HDAC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    103552097 (HDAC1)
   05202 Transcriptional misregulation in cancers
    103552097 (HDAC1)
   05203 Viral carcinogenesis
    103552097 (HDAC1)
   05220 Chronic myeloid leukemia
    103552097 (HDAC1)
  Neurodegenerative diseases
   05016 Huntington's disease
    103552097 (HDAC1)
  Substance dependence
   05034 Alcoholism
    103552097 (HDAC1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    103552097 (HDAC1)
   05165 Human papillomavirus infection
    103552097 (HDAC1)
Enzymes [BR:epz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103552097 (HDAC1)
Chromosome and associated proteins [BR:epz03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     103552097 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     103552097 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    103552097 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    103552097 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 103552097
NCBI-ProteinID: XP_008520120
LinkDB All DBs
Position
Un
AA seq 550 aa AA seqDB search
MVRSPGSSPTPLSPTLVQAQGALGGLSGLPLPPAEFRAVPALADWLERCPGCAAIGVCCK
IPGFCFCWEYVSNCVTETVTLSSSGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME
IYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQL
STGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLY
IDIDIHHGDGVEEAFYTTDRVMTVSFQKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGI
DDESYEAIFKPVISKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFN
LPMLMLGGGGYTIRNVARCWTYETSVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTN
QNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDK
RIACEEEFSDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKEPEEKKEVTEEEKTKEEKQEA
KGVKEEVKLA
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggtacggtccccgggcagctcccccacccccttgtcgccgaccttggtacaggcccag
ggggccctcggcggcctctctgggctgcccttgccccctgccgagttccgggccgtccct
gcgctagctgattggctggagcggtgcccgggctgcgcggctataggcgtttgttgtaaa
attcctgggttctgcttctgctgggagtatgtgtctaactgtgtcactgaaactgtcact
ctttcttcttcaggggatgttggaaattactattatggacaaggccacccaatgaagcct
caccgaatccgtatgacccacaatttgctacttaactatggtctctaccgaaaaatggaa
atctatcgccctcacaaagccaatgctgaggagatgaccaagtaccacagtgatgactac
attaaattcttgcgttccatccgcccagataacatgtctgagtacagcaagcagatgcag
agattcaacgttggtgaggactgtccggtatttgatggcctgtttgagttctgtcagtta
tctactggtggctctgtggcaagtgctgtgaaacttaataagcagcagacggacatcgct
gtgaattgggctgggggcctgcaccatgcaaagaagtccgaggcatctggcttctgttac
gtcaatgatatcgtcttggccatcctggaactgctaaagtatcaccagagggtgctgtat
attgacattgatattcaccacggcgatggcgtggaagaggccttctataccacagaccgg
gtcatgactgtgtcctttcaaaaatacggagagtacttcccaggaactggggacctacgg
gatattggggctggcaaaggcaagtattatgctgttaactacccgctccgagatgggatt
gatgacgagtcctatgaggccattttcaagccggtcatatccaaggtaatggagatgttc
cagcccagtgcagtcgtcttacagtgtggctctgactccctgtctggggatcggttaggt
tgcttcaatctgaccatcaaagggcacgccaagtgtgtggaatttgtgaagagcttcaac
ctgcctatgctgatgctgggaggcggtggctacaccattcgtaatgttgcccggtgctgg
acatatgaaacgtctgtggccctggacacagagatccctaatgagcttccatacaacgac
tactttgaatactttggaccagatttcaaacttcacatcagtccttccaatatgactaac
cagaacactaatgagtacctggagaagatcaaacagcgactgtttgagaacctgagaatg
ctgccccatgcacctggggtccaaatgcaggcgattcctgaggatgccattccagaggag
agtggcgatgaggacgaagaagaccctgacaagcgcatctcaatctgttcctctgacaaa
cgaattgcctgtgaggaagagttctctgactctgatgaggagggagaaggcggtcgcaag
aattcttccaacttcaaaaaagccaagagagtcaaaacagaggatgaaaaagagaaagag
ccagaagaaaagaaagaagtcacagaagaggagaaaaccaaggaggagaagcaagaagcc
aaaggggtcaaggaggaggtcaagttggcctga

DBGET integrated database retrieval system