KEGG   Equus przewalskii (Przewalski's horse): 103552106Help
Entry
103552106         CDS       T04644                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage inducible gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04010  MAPK signaling pathway
epz04068  FoxO signaling pathway
epz04110  Cell cycle
epz04115  p53 signaling pathway
epz04210  Apoptosis
epz04218  Cellular senescence
epz05169  Epstein-Barr virus infection
epz05200  Pathways in cancer
epz05202  Transcriptional misregulation in cancer
epz05210  Colorectal cancer
epz05212  Pancreatic cancer
epz05213  Endometrial cancer
epz05214  Glioma
epz05216  Thyroid cancer
epz05217  Basal cell carcinoma
epz05218  Melanoma
epz05220  Chronic myeloid leukemia
epz05222  Small cell lung cancer
epz05223  Non-small cell lung cancer
epz05224  Breast cancer
epz05225  Hepatocellular carcinoma
epz05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103552106 (GADD45G)
   04068 FoxO signaling pathway
    103552106 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103552106 (GADD45G)
   04210 Apoptosis
    103552106 (GADD45G)
   04115 p53 signaling pathway
    103552106 (GADD45G)
   04218 Cellular senescence
    103552106 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103552106 (GADD45G)
   05202 Transcriptional misregulation in cancer
    103552106 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103552106 (GADD45G)
   05212 Pancreatic cancer
    103552106 (GADD45G)
   05225 Hepatocellular carcinoma
    103552106 (GADD45G)
   05226 Gastric cancer
    103552106 (GADD45G)
   05214 Glioma
    103552106 (GADD45G)
   05216 Thyroid cancer
    103552106 (GADD45G)
   05220 Chronic myeloid leukemia
    103552106 (GADD45G)
   05217 Basal cell carcinoma
    103552106 (GADD45G)
   05218 Melanoma
    103552106 (GADD45G)
   05213 Endometrial cancer
    103552106 (GADD45G)
   05224 Breast cancer
    103552106 (GADD45G)
   05222 Small cell lung cancer
    103552106 (GADD45G)
   05223 Non-small cell lung cancer
    103552106 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    103552106 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:epz03036]
    103552106 (GADD45G)
Chromosome and associated proteins [BR:epz03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     103552106 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     103552106 (GADD45G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L7Ae
Motif
Other DBs
NCBI-GeneID: 103552106
NCBI-ProteinID: XP_008520125
LinkDB All DBs
Position
Un
AA seq 159 aa AA seqDB search
MTLEEVRGQDTVPESTARMQGAGKALHELLLSALRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENHIDIVRVGDVQRLAAIVGAGDEAGAPGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgactctggaagaagttcgcggccaggatacagttccggaaagcacggccaggatgcag
ggcgccgggaaagcgctgcacgagctgctgctatcggcgctgcgccagggctgcctcacc
gccggcgtctacgagtccgccaaagtcctgaacgtggaccccgacaacgtgaccttttgc
gtcctggccgccgacgaggaggacgaaggcgacatcgcgctgcagatccacttcacgctg
atccaggcgttctgctgcgagaaccacatcgacatcgtgcgcgtgggcgacgtgcagcgg
ctggcggcgatcgtgggcgccggcgacgaggcgggcgcgccgggagatctgcactgcatc
ctcatctcgaaccccaatgaggacgcgtggaaggaccctgccttggagaagctcagcttg
ttctgcgaggagagccgcagcgtcaacgactgggtgcccagtatcactctccccgagtga

DBGET integrated database retrieval system