KEGG   Equus przewalskii (Przewalski's horse): 103552305
Entry
103552305         CDS       T04644                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz01521  EGFR tyrosine kinase inhibitor resistance
epz04010  MAPK signaling pathway
epz04014  Ras signaling pathway
epz04015  Rap1 signaling pathway
epz04020  Calcium signaling pathway
epz04072  Phospholipase D signaling pathway
epz04144  Endocytosis
epz04151  PI3K-Akt signaling pathway
epz04510  Focal adhesion
epz04540  Gap junction
epz04630  JAK-STAT signaling pathway
epz04810  Regulation of actin cytoskeleton
epz05163  Human cytomegalovirus infection
epz05200  Pathways in cancer
epz05206  MicroRNAs in cancer
epz05214  Glioma
epz05215  Prostate cancer
epz05218  Melanoma
epz05230  Central carbon metabolism in cancer
epz05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103552305 (PDGFRA)
   04014 Ras signaling pathway
    103552305 (PDGFRA)
   04015 Rap1 signaling pathway
    103552305 (PDGFRA)
   04630 JAK-STAT signaling pathway
    103552305 (PDGFRA)
   04020 Calcium signaling pathway
    103552305 (PDGFRA)
   04072 Phospholipase D signaling pathway
    103552305 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    103552305 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103552305 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103552305 (PDGFRA)
   04540 Gap junction
    103552305 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103552305 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103552305 (PDGFRA)
   05206 MicroRNAs in cancer
    103552305 (PDGFRA)
   05230 Central carbon metabolism in cancer
    103552305 (PDGFRA)
   05231 Choline metabolism in cancer
    103552305 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    103552305 (PDGFRA)
   05218 Melanoma
    103552305 (PDGFRA)
   05215 Prostate cancer
    103552305 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103552305 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103552305 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:epz01001]
    103552305 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:epz04090]
    103552305 (PDGFRA)
Enzymes [BR:epz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103552305 (PDGFRA)
Protein kinases [BR:epz01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   103552305 (PDGFRA)
CD molecules [BR:epz04090]
 Proteins
  103552305 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE LAT Kinase-like
Other DBs
NCBI-GeneID: 103552305
NCBI-ProteinID: XP_008520420
LinkDB
Position
Un
AA seq 1089 aa
MGTCHRALLVLGCLLTGPSLSFCQLSLPSILPNEDEKVVQLNSSFSLRCFGESEVSWQYP
MSEEENPNVEIRNEENNSGLFVTVLEVVSASAAHTGLYTCYYNHTQTEESEIEGRRIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLLSSDGVVLASYDSRQGFNG
TFSVGPYICEATVKGKKFRTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNN
EVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLSVPEATVKDSGDYECAARQATREVK
EMKKVTISVHEKGFIEIKPNFSRLEAVDLHEVKHFVVDVQAYPPPRISWLKDNLTLIENL
TEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILANNISNIITEVHPRD
RSTVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLTPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKAMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttgccatcgggcactcctggtcttaggctgtctcctcacagggcccagccta
agcttctgccagctttcattaccctccatcctcccaaatgaagatgaaaaggttgtgcag
ctgaactcatccttttctctgagatgctttggggagagcgaagtgagctggcagtacccc
atgtctgaagaagagaaccctaacgtggaaatcagaaatgaggaaaacaacagtggcctt
tttgtgacggtgctggaagtggtcagtgcctcagcagcccacacgggattgtacacttgc
tattacaaccacacgcagacagaagaaagcgagatcgaaggcaggcgcatttacatctat
gtgccagaccctgatgtggccttcgtacctctaggaatgacagactatttagtcatcgtg
gaggatgatgattctgccatcatcccttgtcgcacgactgatcctgagactccagtgacc
ttactcagcagtgacggggtggtactcgcctcctacgacagcagacagggctttaacgga
accttcagcgtcgggccctacatctgcgaggccaccgtcaaagggaagaagtttcggacc
atcccatttaatgtttatgctttaaaagcaacatcagaacttgatctagagatggaagct
cttaagactgtgtataagtcgggggaaacgattgtggtcacctgtgccgtctttaacaac
gaggtggttgaccttcagtggacttaccctggagaagtgaaaggcaaaggcatcacaatg
ctggaggaaatcaaggtcccgtccatcaaattggtgtacaccctgagcgtccccgaggcc
acggtgaaagacagtggagattacgaatgtgctgcccgccaggccaccagggaggtcaaa
gaaatgaagaaagtcaccatttctgtccatgagaaaggcttcattgaaatcaaacccaac
ttcagccggctggaagccgttgacctgcatgaggtcaaacattttgtggtggatgtgcag
gcctacccgcctcctaggatatcctggctgaaggacaacctgactctgatcgaaaatctc
actgagatcaccactgacatagaaaagatccaggaaataaggtaccgaagcaaattaaag
ctgatccgtgcaaaggaagaagacagtggtcattatactattgtagttcaaaatgaagat
gatgtaaagagctatacctttgaactcttaactcaagttccctcatctattctggacttg
gtcgacgaccaccatggctctaccgggggtcagactgtgagatgcacagctgaagggacc
cctcttcctgacattgagtggatgatttgcaaggatattaagaaatgtaataatgaaact
tcgtggacgattttggctaacaacatctcaaacatcatcacggaggtccacccccgagac
aggagtactgtggagggccgagtgacgtttgccaaagtggaggagaccattgccgttcgg
tgtctggctaagaatctccttggggctgagaaccgagagctgaagctggtggctcccact
ctacgttctgaactcacagtggcagctgcggtcctggtgctgttggtgattgtgatcatc
tcacttattgtcctggttgtcatttggaagcagaaaccgaggtacgaaattcgttggagg
gtcattgaatcaatcagccctgatggacatgaatatatttatgtggacccgatgcagctg
ccttatgactcgagatgggagtttccaagagatggcctcgtgcttggtcgtatcctggga
tctggtgcgtttgggaaagtggtcgaaggaactgcttatggattaagccggtcccaacct
gtcatgaaagtagctgtgaagatgctaaaacccacagccagatctagtgaaaaacaagct
ctcatgtcggaactgaagataatgactcacctggggccgcatttaaacattgtgaacttg
ctgggagcctgtaccaagtcaggcccaatttacatcatcacggagtactgcttctatggg
gatttggtcaactatttgcataagaatagggacagcttcctgagccgccacccagagaag
ccaaagaaagagctggacatctttggattgacccctgctgatgaaagcacacggagttat
gttattttatcttttgaaaacaatggtgactacatggacatgaagcaagctgataccaca
cagtatgtccccatgctggagaggaaagaggtttctaaatattcggacatccagaggtcg
ctgtatgatcgcccagcctcatataagaagaaagctatgttagactcagaagtcaaaaac
ctcctttcggatgataactcagaaggcctaactttgctggatttgttgagcttcacttat
caagttgcccgaggaatggagtttttggcttcaaagaattgtgtccaccgggacctggct
gctcgcaacgtcctcctggcacaagggaaaattgtgaagatctgtgactttggcctggcc
agagacatcatgcatgattccaactacgtgtccaaaggcagcacctttctccctgtgaag
tggatggctcctgagagcatcttcgacaacctctacaccacgctgagtgacgtctggtct
tacggcattctgctctgggagatcttttctcttggtggcacaccctaccctggcatgatg
gtggattctactttctacaataagatcaagagtgggtaccggatggccaagcctgaccat
gccaccagtgaagtctatgagatcatggtgaagtgctggaacagtgagccggagaagagg
ccctccttttaccacctgagtgagattgtggagaatctgctgcctggacaatataaaaag
agttatgaaaagattcacctggacttcctgaagagcgatcatcccgccgtggcacgcatg
cgcgtggactctgacaacgcctacattggcgtcacctacaaaaatgaggaagacaagctg
aaggactgggagggtggcctcgacgagcagaggttgagtgcggacagtggctacatcatc
cctctgccggacatcgaccctgttccggaggaggaagacctgggcaagaggaacagacac
agctcgcagacctctgaagagagtgccatcgagacaggttccagcagttctaccttcatt
aagagagaggatgagaccattgaggacatcgacatgatggacgacattggcatagactcc
tcagacctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system