KEGG   Equus przewalskii (Przewalski's horse): 103552733
Entry
103552733         CDS       T04644                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz01522  Endocrine resistance
epz04012  ErbB signaling pathway
epz04066  HIF-1 signaling pathway
epz04068  FoxO signaling pathway
epz04110  Cell cycle
epz04151  PI3K-Akt signaling pathway
epz04933  AGE-RAGE signaling pathway in diabetic complications
epz04934  Cushing syndrome
epz05162  Measles
epz05165  Human papillomavirus infection
epz05169  Epstein-Barr virus infection
epz05200  Pathways in cancer
epz05202  Transcriptional misregulation in cancer
epz05203  Viral carcinogenesis
epz05206  MicroRNAs in cancer
epz05215  Prostate cancer
epz05220  Chronic myeloid leukemia
epz05222  Small cell lung cancer
epz05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103552733 (CDKN1B)
   04066 HIF-1 signaling pathway
    103552733 (CDKN1B)
   04068 FoxO signaling pathway
    103552733 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    103552733 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103552733 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103552733 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    103552733 (CDKN1B)
   05206 MicroRNAs in cancer
    103552733 (CDKN1B)
   05203 Viral carcinogenesis
    103552733 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    103552733 (CDKN1B)
   05220 Chronic myeloid leukemia
    103552733 (CDKN1B)
   05215 Prostate cancer
    103552733 (CDKN1B)
   05222 Small cell lung cancer
    103552733 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103552733 (CDKN1B)
   04934 Cushing syndrome
    103552733 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    103552733 (CDKN1B)
   05169 Epstein-Barr virus infection
    103552733 (CDKN1B)
   05165 Human papillomavirus infection
    103552733 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103552733 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103552733
NCBI-ProteinID: XP_008521148
LinkDB
Position
Un
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDASANRQAVPLIG
SQANSEDTHLVDPKTDTSDSPTGLAEPCTGIRKRPAADDSSPQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtccaacgggagcccgagcctggagcggatggacgccagacag
gcggagtaccccaagccgtccgcctgcagaaacctcttcggtccggtgaatcacgaagag
ttaacccgggacttggagaagcactgccgagacatggaagaggccagccagcgcaagtgg
aattttgatttccagaatcacaagcccctggagggcaaatacgagtggcaggaggtggaa
aagggcagcttgcccgagttctactacagacccccgcggccacccaaaggcgcctgcaag
gtgccggcgcaggagagccaggatgccagcgcgaaccgccaggcggtgcctttaattggg
tctcaggcaaactcagaggacacgcatttggtagacccaaagactgatacgtcggacagc
cccacgggcttagcggagccgtgcactgggatcaggaagcgacctgcagcagacgattcc
tctcctcaaaacaaaagagccaacagaacagaagaaaatgtttcagacggttccccgaac
gcgggctcagtggagcagacgcccaagaagccgggcctccgaagacgtcaaacgtaa

DBGET integrated database retrieval system