KEGG   Equus przewalskii (Przewalski's horse): 103553309Help
Entry
103553309         CDS       T04644                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00500  Starch and sucrose metabolism
epz01100  Metabolic pathways
epz04151  PI3K-Akt signaling pathway
epz04152  AMPK signaling pathway
epz04910  Insulin signaling pathway
epz04922  Glucagon signaling pathway
epz04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103553309 (GYS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    103553309 (GYS1)
   04152 AMPK signaling pathway
    103553309 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103553309 (GYS1)
   04922 Glucagon signaling pathway
    103553309 (GYS1)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04931 Insulin resistance
    103553309 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:epz01003]
    103553309 (GYS1)
Enzymes [BR:epz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     103553309 (GYS1)
Glycosyltransferases [BR:epz01003]
 Polysaccharide
  Storage polysaccharide
   103553309 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 103553309
NCBI-ProteinID: XP_008522039
LinkDB All DBs
Position
Un
AA seq 737 aa AA seqDB search
MPLNRTLSMSSLPGLDDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCTHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPEHFTYEPREADATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDVPPDEDSERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRGSVDTGPSSSLS
TPSEPLSPASSLGEERN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaaaccgcactttgtccatgtcctcactgccaggactggacgattgggaggat
gaattcgacctggagaatacagtgctcttcgaggtggcctgggaggtggccaacaaggtg
ggtggcatctacacggtgctacagacgaaggcgaaggtgacaggggatgaatggggcgac
aactactacctggtgggaccatacacggagcaaggcgtgaggacccaggtggagctgctc
gagcccccaaccccggccctgaagaggacgctggactccatgaacagcaagggctgcaag
gtgtatttcgggcgctggctgatcgaggggggccccctggtggtgctcctggatgtgggg
gcctcagcctgggccctggaacgctggaagggagagctttgggacacctgcaacatcggg
gtgccctggtacgaccgtgaggccaacgacgccgtcctttttggcttcctcaccacctgg
ttcctgggtgagttcctggcccagagcgaggagaagccacatgtggttgcacacttccac
gagtggttggcgggcatcgggctctgcctgtgccgtgcccggcggctgcctgtggctaca
atcttcaccacccacgccacgctgctggggcgatacctgtgtgccggtgctgtggacttc
tacaacaacctggagaatttcaacgtggacaaggaagctggtgagaggcaaatttatcac
cgttactgcatggagcgggcggcagcccactgcactcacgtcttcactaccgtgtcccag
atcaccgccattgaggctcagcacctactcaagaggaaaccagatatcgtgacccccaat
ggactgaatgtgaagaagttctctgccatgcatgagttccagaacctccatgctcagagc
aaggcccgaatccaggagtttgtgcgtggccatttttatgggcacctggacttcaacttg
gataagaccctgtatttctttatcgccggccgctacgagttctccaacaagggggctgac
gtcttcctggaggccttggcccggctcaactatctgctcagagtaaatggcagcgagcag
acggtggtcgccttcttcatcatgccggctcggaccaacaacttcaacgtggaaaccctc
aaggggcaagccgtgcgcaagcagctctgggatacggcgaacacagtgaaggagaagttc
gggaggaagctttacgaatccctgctggttgggagcctcccggacatgaacaagatgctg
gacaaggaggatttcactatgatgaagagagccatctttgccacgcagcggcagtctttt
ccccctgtgtgcacccacaatatgctggacgactcctcggaccctatcctgaccaccatc
cgtcgaatcggcctcttcaatagtagtgctgacagggtcaaggtgattttccacccagag
ttcctctcctccacgagccccctgctccccgtggactatgaggagtttgtccgtggctgc
caccttggggttttcccctcctactatgagccttggggctacacaccagctgagtgcacg
gttatgggcatccccagtatctccaccaacctctccggcttcggctgcttcatggaggaa
cacatcgcagacccctcagcttacggcatctacattctggaccggcggttccgcagcctg
gatgattcctgctcgcagcttacctccttcctctacagcttctgccagcagagccggcgg
cagcgcatcatccagcggaaccgcacggagcgcctctccgaccttctggactggaaatac
ctaggccggtactatatgtccgcgcgccacatggcgctggccaaggcctttccagaacat
ttcacctacgagccccgcgaggctgatgcgacccagggctaccgctacccacggcctgca
tcggtgcctccgtcgccctcactgtcacgacactcgagcccgcaccagagcgaggacgag
gaggagccccgggacgtgccgcccgatgaagacagtgagcgctacgacgaggacgaggag
gccgccaaggaccggcgcaacatccgcgccccggagtggccgcgtcgcgcctcctgcacc
tcttccacgagcgggagcaagcgcggctcggtggacacggggccctccagctcgctcagc
acccccagcgagcccctcagccccgccagctccctgggcgaggagcgcaactaa

DBGET integrated database retrieval system