KEGG   Equus przewalskii (Przewalski's horse): 103553442Help
Entry
103553442         CDS       T04644                                 

Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9-like
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00512  Mucin type O-glycan biosynthesis
epz01100  Metabolic pathways
Module
epz_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    103553442
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:epz01003]
    103553442
Enzymes [BR:epz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     103553442
Glycosyltransferases [BR:epz01003]
 O-Glycan biosynthesis
  Mucin-type
   103553442
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_transf_7C GNT-I
Motif
Other DBs
NCBI-GeneID: 103553442
NCBI-ProteinID: XP_008522234
LinkDB All DBs
Position
Un
AA seq 411 aa AA seqDB search
MAATLRDDSQDTESKFEEYGYNAQLSDRISLDRTIPDYRPQKCRQMTYSDDLPQISVVFI
FVNEALSVILRSVHSVVNHTPSQLLKEVILVDDDSDNVELKFNLDQYVNKRYPGLVKIVR
NSRREGLIRARLQGWKAATAPVLLKPRSYLRGGGPRDTRLAEPALTRIREDRRRIVLPAI
DNIKYDTFEVQQYASAAHGYNWGLWCMYIIPPQDWLDRGDEAAPIRTPAMIGCSFVVDRE
YFGDIGLLDPGMEVYGGENVELGMRVWQCGGSMEVLPCSRVAHIERTRKPYNNDIDYYAK
RNALRAAEVWMDGFKSHVYMAWNIPMTNPGVDFGDVSERLALRQRLKCRSFKWYLENVYP
EMRTYNNTLTYGEVRNSKASGYCLDQGAEDDDLVVGPSLASPAAASLVALD
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggcggccacactgcgtgacgacagccaggacacagaaagcaagtttgaggaatacgga
tacaacgctcagctcagcgaccgcatctccctggacaggaccatccctgactacaggccc
caaaagtgcagacagatgacctattccgacgacctgccccagatctccgtggtgttcatc
ttcgtcaatgaggccctctcagtcatcctgcgctccgtccacagcgtggtcaaccacact
ccctcccagctcctcaaggaggtcatcttggtggacgatgacagtgacaatgtggagctc
aagttcaacctggaccagtacgtcaacaagaggtacccgggcctcgtgaagatcgtccgc
aacagtaggagagaaggcttgatccgggcgcggctgcagggctggaaggcggccacggcc
cccgtcctcctcaaacccagaagctacctgcgagggggcggacctcgggacacgcgtctg
gccgagcccgccctcacacggatccgggaggaccgccggcgcatcgtgctgcccgccatc
gacaacatcaagtacgacacgttcgaggtgcagcagtacgccagcgcggcccacggctac
aactggggcctctggtgcatgtacatcatcccgccccaggactggctggaccgcggcgat
gaggcggcacccatcaggaccccggccatgatcggctgctcatttgtggtggaccgagag
tacttcggggacattggcctgctggacccgggcatggaggtgtacgggggcgagaacgtc
gagctgggcatgcgggtgtggcagtgcggtggcagcatggaggtgctgccctgctcccgc
gtggcccacatcgagcgcaccaggaagccctacaacaacgacatcgactactatgccaag
cgcaacgccctgcgggcggccgaggtgtggatggacggcttcaagtcccacgtgtacatg
gcctggaacatccccatgactaacccaggcgtggacttcggggacgtgtcggagcggctg
gccctgcgccagcggctgaagtgccgaagcttcaaatggtacctggagaacgtgtacccg
gaaatgaggacctacaacaacaccctcacgtacggagaggtgagaaacagcaaagccagc
ggctactgcttggaccagggagcagaagacgacgacctcgtggtgggaccctcgctggcc
tccccagcagctgccagcctggtggccctggactga

DBGET integrated database retrieval system