KEGG   Equus przewalskii (Przewalski's horse): 103553933
Entry
103553933         CDS       T04644                                 

Definition
(RefSeq) interferon-inducible protein AIM2-like
  KO
K12966  absent in melanoma 2
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04621  NOD-like receptor signaling pathway
epz04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:epz00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103553933
   04623 Cytosolic DNA-sensing pathway
    103553933
SSDB
Motif
Pfam: HIN PYRIN
Other DBs
NCBI-GeneID: 103553933
NCBI-ProteinID: XP_008522925
LinkDB
Position
Un
AA seq 347 aa
MESKYKEILLLTGLDNITDEELDRFKFFLPDELKVSTAKLENANRTEVANLMIQNVGAVS
AVTKTIHVFQKLNYMHVAKSLQEEKEKVDKKYKGKKGTQQVKKRSQTEMSPGASAAPRNS
VVEQHIAPEVSPHVKPKQKQMVAKQEPIRKEGLQKGSMTVMVLKATKPFEFETKEGKQEM
FHATVATESEFFFVKVFNKKLKDKFTPKNIIIISKYYWHSHFLEVNSVSRVSDAKSDQQI
SVPKHIIRKAGETPKINKLQTQPHGTIVNGVFVIQKKTERRNHQLFDLSDSTGRMEVLVL
GKQNKIECEEGDKLRLTFFELSRTGEKLQLKSGIHSLVKVIKAKKLK
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggagagtaaatataaggaaatcctcttattaactggcctggataacatcactgatgag
gaactggatcgatttaaattcttccttccagatgagttaaaagtctccacagcaaaacta
gaaaatgcaaataggacagaggtagcaaacttgatgattcaaaatgttggtgcagtgtct
gcagtgacgaagaccatacatgttttccagaagctgaattatatgcatgtggcaaaaagt
cttcaggaagagaaggagaaagttgataagaaatacaaagggaaaaaaggaacacagcaa
gtgaaaaagagaagtcaaactgaaatgagtcctggtgcctctgcagctcccagaaatagt
gtcgtggagcaacacattgcaccagaagtctctcctcatgttaagcctaagcagaaacag
atggtggccaagcaggaacctatcaggaaagaagggttgcagaaaggctctatgacagtc
atggtgctgaaagcaacgaagccattcgaatttgagaccaaagaagggaagcaagagatg
tttcacgctacagtggctactgagagtgaattcttttttgtaaaagttttcaacaaaaag
ctaaaggataaattcactccaaagaatataattataatatccaaatattattggcacagt
catttcctggaagtgaatagtgtctcacgtgtgtctgatgccaaatctgaccaacaaatc
agtgtcccaaagcacattatcagaaaagctggtgaaaccccaaagatcaataagcttcaa
actcagccccatggaacaattgtgaatggggtgtttgtaatccagaagaaaacagaacgg
aggaatcatcagttatttgacctaagtgacagtacagggaggatggaagtgttggtgctt
ggaaaacagaacaaaattgaatgcgaagaaggggataaacttcgacttacgttctttgag
ctatcaagaactggagaaaaactacagctgaaatctggaattcacagtttagttaaggtt
attaaggcaaaaaaactgaaatga

DBGET integrated database retrieval system