KEGG   Equus przewalskii (Przewalski's horse): 103554562Help
Entry
103554562         CDS       T04644                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00010  Glycolysis / Gluconeogenesis
epz00053  Ascorbate and aldarate metabolism
epz00071  Fatty acid degradation
epz00280  Valine, leucine and isoleucine degradation
epz00310  Lysine degradation
epz00330  Arginine and proline metabolism
epz00340  Histidine metabolism
epz00380  Tryptophan metabolism
epz00410  beta-Alanine metabolism
epz00561  Glycerolipid metabolism
epz00620  Pyruvate metabolism
epz01100  Metabolic pathways
Module
epz_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103554562 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    103554562 (ALDH2)
   00620 Pyruvate metabolism
    103554562 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103554562 (ALDH2)
   00561 Glycerolipid metabolism
    103554562 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103554562 (ALDH2)
   00310 Lysine degradation
    103554562 (ALDH2)
   00330 Arginine and proline metabolism
    103554562 (ALDH2)
   00340 Histidine metabolism
    103554562 (ALDH2)
   00380 Tryptophan metabolism
    103554562 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103554562 (ALDH2)
Enzymes [BR:epz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103554562 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh HetR_C
Motif
Other DBs
NCBI-GeneID: 103554562
NCBI-ProteinID: XP_008523900
LinkDB All DBs
Position
Un
AA seq 422 aa AA seqDB search
MDASDRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADK
YHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTP
LTALYVANLTKEAGFPPGVVNVVPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAG
RSNLKKVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYAEF
VERSVARARSRVVGNPFDSQTEQGPQVDETQFNKVLGYIKSGKEEGAKLLCGGGAAADRG
YFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDK
ANYLSQALQAGTVWINCYDVFGAQSPFGGYKMSGNGRELGEYGLQAYTEVKTVTIKVPQK
NS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggatgcatctgacaggggccggctgctgaaccgcttggctgatctgattgaacgggac
cggacctacctggcagccttggagaccctggataatggcaagccctacgtcatctcttac
ctggtggatttggacatggtcctcaaatgtctccgttattatgctggctgggccgataag
taccatgggaaaaccattcccatcgatggggacttcttcagctacacccgccatgaacct
gtgggggtgtgtgggcagatcattccgtggaacttcccactcttgatgcaagcatggaaa
ctgggcccagccttggcgactggaaacgtggttgtgatgaaggtggccgagcagactcca
ctcactgccctctatgtggccaacttgactaaggaggctggctttccccctggcgtggtc
aatgttgttcctggatttggccccacggctggggctgccattgcctcccatgaggatgtg
gacaaagtagctttcacaggctccactgaggttggccacctaatccaggttgctgcaggg
aggagtaacctcaagaaagtgaccctggagctgggaggaaaaagccctaacatcatcatg
tcagatgctgacatggactgggcggtggagcaggcccacttcgccctgttcttcaaccag
ggccagtgctgctgtgcgggctcccggacctttgtgcaggaggatgtttacgctgagttt
gtggagcgcagcgttgcccgggcccggtctcgtgtggttgggaacccctttgacagccag
accgagcaggggccacaggtggatgaaactcagtttaataaggtccttggctatatcaaa
tctgggaaggaagagggggcgaagctgctgtgtggtggaggggcagctgctgaccgtggc
tacttcatccagcccactgtgttcggagatgtgcaagatggcatgacaatcgcaaaggag
gagatcttcgggccagtgatgcagatcctgaagttcaagaccatagaggaagtcgtcggg
agagccaacaattccaagtatgggctggccgcagctgtcttcacaaaggacttggacaaa
gccaattatctgtcccaagccctccaggctggcactgtgtggatcaactgctatgacgtg
tttggggcccagtcaccatttggtggctacaagatgtctgggaacggccgggagctggga
gagtatggcctgcaggcatacaccgaggtgaaaactgtcacaatcaaagttcctcagaag
aactcataa

DBGET integrated database retrieval system