KEGG   Equus przewalskii (Przewalski's horse): 103555517
Entry
103555517         CDS       T04644                                 

Gene name
KITLG
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04010  MAPK signaling pathway
epz04014  Ras signaling pathway
epz04015  Rap1 signaling pathway
epz04072  Phospholipase D signaling pathway
epz04151  PI3K-Akt signaling pathway
epz04640  Hematopoietic cell lineage
epz04916  Melanogenesis
epz05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103555517 (KITLG)
   04014 Ras signaling pathway
    103555517 (KITLG)
   04015 Rap1 signaling pathway
    103555517 (KITLG)
   04072 Phospholipase D signaling pathway
    103555517 (KITLG)
   04151 PI3K-Akt signaling pathway
    103555517 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103555517 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    103555517 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103555517 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:epz04052]
    103555517 (KITLG)
Cytokines and growth factors [BR:epz04052]
 Growth factors
  Growth factors (RTK binding)
   103555517 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 103555517
NCBI-ProteinID: XP_008525360
LinkDB
Position
Un
AA seq 210 aa
PSHCWISEMVQHLSVSLTDLLEKFSNISEGLSNYSIIDKLVKIVDDLVECMEEHSSENVK
KSYKSQESRLFTPEEFFRIFNRSIDAFKDLEMVVSKTSECVVSSTLSPEKDSRVSVTKPF
MLPPVAASSLRNDSSSSNRKASNFTGDSNLQWAAMALPAFFSLVIGFAFGALYWKKKQPN
LTRAVENIQINEEDNEISMLQEKEREFQEV
NT seq 633 nt   +upstreamnt  +downstreamnt
cctagtcattgttggataagcgagatggtgcaacacttgtcagtcagcttgactgatctc
ttggagaagttttcaaatatttctgaaggcttgagtaattattctatcatagacaaactt
gtgaaaatagtggatgatcttgtggagtgcatggaagaacactcatctgagaatgtaaaa
aaatcatataagagccaagaatccaggctatttactcctgaagaattctttagaattttt
aatagatccatcgatgccttcaaggacttggagatggtggtatctaaaactagtgaatgt
gtggtgtcttcaacattaagtcctgaaaaagattccagagtcagtgtcacaaaaccattt
atgttaccccctgttgcagccagctcccttaggaatgacagcagtagcagtaataggaag
gcctcaaatttcactggagactccaacctacaatgggcagccatggcattgccagcattc
ttttctcttgtaattgggtttgcttttggagccttatactggaagaagaaacaaccaaat
cttacaagggcagttgaaaatatacagattaacgaagaggataatgagataagtatgttg
caagaaaaagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system