KEGG   Equus przewalskii (Przewalski's horse): 103555981Help
Entry
103555981         CDS       T04644                                 

Gene name
NEU2
Definition
(RefSeq) neuraminidase 2
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00511  Other glycan degradation
epz00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    103555981 (NEU2)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    103555981 (NEU2)
Enzymes [BR:epz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     103555981 (NEU2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR Sortilin-Vps10
Motif
Other DBs
NCBI-GeneID: 103555981
NCBI-ProteinID: XP_008526053
LinkDB All DBs
Position
Un
AA seq 417 aa AA seqDB search
MQELHSSSSGTGFHCLCSPTLTSHPGPEIRLGTLSLSPMASCPILQKEKVFQSGAHAYRI
PALLYLPQQKTLLAFAEKRRDKRDEHAELIALRKGSYDVATHRVLWHAEEVVTQAQLEGH
RSMNPSPLYDKKTGTLFLFFIAIPGQVSERHQLHTRVNVTRLCQVTSTDHGRSWSPARDV
TDSIIGSAYKEWATFALGPGHCLQLHNESQSLVVPAYAYRNLHPRHRPAPFAVCFISHDH
GHTWQRGNFVAQDTLECQVAEVGSTKQRVVYLNARSPLRARVQAESNNDGLDFKEIQLVT
KLAEPPQGCQGSIVSFPNPTVQSDFSDKWLLYTHPTDSRQRSNLGVYLNKWPLAPTAWSE
PTLLAKGSCAYSDLQSMGAGPDGSPQFACLYESNNYEEIIFLMFTLKQAFPAEFLPQ
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagctgcactcttcttcttctggaactgggttccactgcctctgctcacccaca
ctgacttcccacccaggcccggagatccgacttggaacactctccttgagccccatggca
tcctgccccatcctgcagaaggagaaagtgttccagtccggagcccatgcctacagaatc
cctgctctgctctacctgcctcagcagaagaccctgctggcctttgcagaaaagcggagg
gacaagagggatgaacatgcagagctgattgccctgcgcaaaggaagctatgatgtggcc
acccaccgggtcctgtggcacgctgaggaggtggtgacccaagcccagctggagggccac
cggtccatgaacccgagccccttgtatgacaagaagacggggaccctcttcctcttcttc
attgccatccccgggcaggtctccgagcgccaccagctccacaccagggtcaacgtgaca
cggctgtgccaagtcaccagcaccgaccacgggaggtcctggagccccgccagagacgtc
actgactccatcattggctcggcctacaaggaatgggccacttttgcgctgggcccggga
cactgtctgcagctgcacaacgagtcacagagtctggtggtgcctgcttacgcttaccgg
aaccttcacccccgccacaggcctgcccccttcgctgtctgcttcatcagccacgaccat
gggcacacgtggcaaagagggaactttgtggcccaggacaccctggagtgccaagtggct
gaggtcgggagtacaaaacagagggtggtgtatctgaacgctagaagtccgctccgagcc
agggtccaggctgagagcaacaacgatgggctggatttcaaggagatccaactagtgaca
aagcttgcggaacctccccaaggctgccaggggagcatcgtcagctttcccaaccccaca
gttcagtcagacttctcagacaagtggctgctgtacacccaccccactgactcccggcag
agatccaacctgggcgtgtacctcaacaagtggcccctggcccccacggcctggtcggag
cccactctgctggccaagggcagctgcgcttactcagatctccagagcatgggtgccggc
ccggatgggtcaccccagtttgcatgtctgtacgaatcaaataattacgaggagatcatc
ttcctcatgttcaccctgaaacaagccttcccagcggagtttctgcctcagtga

DBGET integrated database retrieval system