KEGG   Equus przewalskii (Przewalski's horse): 103555986Help
Entry
103555986         CDS       T04644                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04371  Apelin signaling pathway
epz05034  Alcoholism
epz05165  Human papillomavirus infection
epz05169  Epstein-Barr virus infection
epz05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103555986 (HDAC4)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    103555986 (HDAC4)
  09165 Substance dependence
   05034 Alcoholism
    103555986 (HDAC4)
  09172 Infectious diseases: Viral
   05169 Epstein-Barr virus infection
    103555986 (HDAC4)
   05165 Human papillomavirus infection
    103555986 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:epz03036]
    103555986 (HDAC4)
Enzymes [BR:epz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103555986 (HDAC4)
Chromosome and associated proteins [BR:epz03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     103555986 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 103555986
NCBI-ProteinID: XP_008526062
LinkDB All DBs
Position
Un
AA seq 1104 aa AA seqDB search
MYWLVEATKNAPIPTDPQIPVTSHGQDRFLSTVLLTPAQDGLSGRDQPVELLNPARVNHM
PSTVDVAAALPLQVAPPAVPMDLRLDHQFSLPVTEPTLREQQLQQELLALKQKQQLQRQI
LIAEFQRQHEQLSRQHEAQLHEHIKQQQELLAMKHQQELLEHQRKLERHRQEQELEKQHR
EQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQH
SSLDQSSPPQSGVSASYNHPVLGMYDAKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPL
LRRKDGPVVTALKKRPLDVTDSACSSAPGSAPSSPNNSSGNVSTENGIAPAVPSIPAETS
LAHRLVTREGSVAPLPLYTSPSLPNITLGLPATGPSAGAAGQQEAERLALPALQQRISLF
PGTHLTPYLSTAPLERDGAAAHNPLLQHMVLLEQPPAQTPLVTDWYLSGLGALPLHAQSL
VGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHLVIQQQHQQFLEKHKQQFQQQQLH
MNKIIPKPSEPARQPESHPEETEEELREHQALLEEPYRDRLSGQKEAHALTGVQVKQEPI
ESDDEEAEPPREAEPGQHQPTEQELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFGG
HRPLSRAQSSPASATFPMSVQEPPTKPRFTTGLVYDTLMLKHQCTCGNTNSHPEHAGRIQ
SIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSSLTSVFVR
LPCGGVGVDSDTIWNEVHSSGAARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEEST
PMGFCYFNSVAIAAKLLQQRLNVSKTLIVDWDVHHGNGTQQAFYNDPNVLYISLHRYDDG
NFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPPMGDAEYLAAFRTVVMPIANEFAPDVVL
VSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQLMGLAGGRIILALEGGHDLTAICDASEAC
VSALLGNELDPLPEKVLQQRPNANAVRSMEKVIEIHSQYWRSLRRPSSTAGHSLVEAQKC
ETEEAETVTAMASLSVGVKPAEKR
NT seq 3315 nt NT seq  +upstreamnt  +downstreamnt
atgtattggctagtggaagccacaaagaacgctccaatccccacggatccccagatccca
gtgacgagccacggacaggaccgctttctgagcaccgtgctcctgacgccagcccaggat
ggactttctggccgagaccagccagtggagctgctgaaccctgcccgcgtgaaccacatg
cccagcacagtggacgtggccgcggcgctgcctttgcaagtcgcccccccggcggtgccc
atggacctgcgcctggaccaccagttctcgctgcccgtgacggagcccaccctgcgggag
cagcagctgcagcaggagctcctggccctcaagcagaagcagcagctccagaggcagatc
ctcatcgccgagttccagaggcagcacgagcagctctcgcggcagcacgaggcccagctg
cacgagcacatcaaacaacagcaggagctgctggccatgaagcaccagcaggagctgcta
gagcatcagcggaagctggagagacaccgccaggagcaggagctggagaagcagcaccgc
gagcagaagctgcagcagctcaagaacaaggagaaaggcaaagagagtgccgtggccagc
acggaagtgaagatgaagttacaagagtttgtcctcaacaagaagaaggcgctggcccac
cgcaacctgaaccactgcatttccagcgacccccgctactggtacgggaaaacgcagcac
agttcccttgaccagagctccccgccccagagtggggtgtcggcctcctacaaccacccg
gtcctgggaatgtatgacgccaaagacgacttccctctcagaaaaacagcttctgaaccc
aatctgaagttacggtctaggctaaagcagaaagtggccgagagacggagcagccccctg
ttacgcaggaaagacgggccagtggttactgctctgaaaaagcgtcccctggatgtcaca
gactcggcatgcagcagcgccccgggctcggcacccagctcgcccaacaacagctccggg
aacgtgagcacggagaacgggatcgcgcccgccgtccccagcatcccggccgagaccagc
ttggcgcacagacttgtgactcgggaaggctccgtggctccgcttcccctctacacatca
ccgtccttgcccaacatcaccctgggacttcctgccactggcccttccgctggggcagca
ggccagcaggaagctgagcgactcgctctcccagccctccaacagcggatctccctcttt
cccggcacccacctcacaccatacctgagcacagcgcccctggagcgggacggcgcggcg
gctcacaaccccctcctgcagcacatggtcttactggagcagccgcctgcacagacgccc
ctcgtcacagactggtatctttcaggcctgggagcactgcccctgcacgcgcagtctctg
gttggtgcggaccgggtgtccccgtccatccacaagctgcggcagcaccgcccgctgggg
cgcacgcagtcggccccactgccccagaacgcgcaggccctgcagcacctggtgatccag
cagcagcatcagcagttcctggagaagcacaagcagcagttccagcagcagcagctgcac
atgaacaagattatccccaagcccagcgagccggcccggcagcccgagagccaccctgag
gagacggaggaggagctccgcgagcaccaggccctcctggaggagccctaccgggaccgg
ctctccgggcagaaggaggcgcacgcactgaccggagtgcaggtgaagcaggagcccatc
gagagtgacgatgaggaggccgagcccccgcgggaggcggagccgggccagcaccagcct
acggagcaggagctgctcttcagacagcaagccctcctcctggagcagcagcgcatccac
cagctgaggaactaccaggcgtccatggaggccgctggcatccccgtgtcctttggcggc
caccggcctctgtcccgggcacagtcgtctccagcgtctgccaccttccccatgtctgtg
caggagccccccaccaagccgaggttcaccacaggcctggtgtacgacacgctgatgctg
aagcaccagtgcacctgcgggaacactaacagccacccggagcacgccgggaggatccag
agcatctggtcccggctgcaggagaccggcctccgaggcaaatgtgagtgcatccgtgga
cggaaggccaccttggaggagctgcagacggtgcattcagaggcgcacaccctgctctac
ggcacaaaccccctcaacaggcagaaactggacagctcactgacttcggtgtttgtcagg
ctgccctgtggtggtgtcggggtggacagcgacaccatatggaacgaggtgcactcgtca
ggggcagcccgcctggccgtgggctgcgtggtggagctggtcttcaaggtggccacgggg
gagctgaagaatggctttgccgtggtccgccccccgggacatcacgcagaagagagcaca
cccatggggttctgctacttcaactctgtggccatcgcagccaagcttctccagcaaagg
ctgaacgtgagcaagaccctcatcgtggactgggacgtgcaccacggaaatgggacccag
caggcattctacaacgacccaaatgtcctgtacatctccctacaccgctacgacgacggg
aacttcttcccgggcagcggggcgcctgacgaggtgggcacagggccgggcgtgggcttc
aacgtcaacatggctttcaccggcggcctcgacccccccatgggagatgcggagtacctg
gcggccttcagaacggtggtcatgcccatcgcgaacgagtttgccccggacgtggtgctg
gtgtcatcaggcttcgacgctgtggagggccaccccacgccgctcggcggctacaacctc
tcagccaaatgtttcgggtacctgacgaagcagctgatgggcttggctggcggccggatt
attctggccctggaggggggccacgacctcacggccatttgcgacgcctcggaagcatgt
gtttctgctttgctgggaaacgagcttgatcctctcccagaaaaggttttacagcagaga
cccaatgctaacgctgtccggtccatggagaaggtcattgaaatccacagccagtactgg
cgctcgctgcggcggccctcctccacggcggggcactcgctcgtcgaggcccagaagtgc
gagaccgaggaagccgagaccgtcaccgccatggcctcgctgtccgtgggcgtgaagccg
gccgagaagaggtga

DBGET integrated database retrieval system