KEGG   Equus przewalskii (Przewalski's horse): 103555986Help
Entry
103555986         CDS       T04644                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04371  Apelin signaling pathway
epz05034  Alcoholism
epz05165  Human papillomavirus infection
epz05169  Epstein-Barr virus infection
epz05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103555986 (HDAC4)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    103555986 (HDAC4)
  09164 Substance dependence
   05034 Alcoholism
    103555986 (HDAC4)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    103555986 (HDAC4)
   05165 Human papillomavirus infection
    103555986 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:epz03036]
    103555986 (HDAC4)
Enzymes [BR:epz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103555986 (HDAC4)
Chromosome and associated proteins [BR:epz03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     103555986 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 103555986
NCBI-ProteinID: XP_008526062
LinkDB All DBs
Position
Un
AA seq 1104 aa AA seqDB search
MYWLVEATKNAPIPTDPQIPVTSHGQDRFLSTVLLTPAQDGLSGRDQPVELLNPARVNHM
PSTVDVAAALPLQVAPPAVPMDLRLDHQFSLPVTEPTLREQQLQQELLALKQKQQLQRQI
LIAEFQRQHEQLSRQHEAQLHEHIKQQQELLAMKHQQELLEHQRKLERHRQEQELEKQHR
EQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQH
SSLDQSSPPQSGVSASYNHPVLGMYDAKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPL
LRRKDGPVVTALKKRPLDVTDSACSSAPGSAPSSPNNSSGNVSTENGIAPAVPSIPAETS
LAHRLVTREGSVAPLPLYTSPSLPNITLGLPATGPSAGAAGQQEAERLALPALQQRISLF
PGTHLTPYLSTAPLERDGAAAHNPLLQHMVLLEQPPAQTPLVTDWYLSGLGALPLHAQSL
VGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHLVIQQQHQQFLEKHKQQFQQQQLH
MNKIIPKPSEPARQPESHPEETEEELREHQALLEEPYRDRLSGQKEAHALTGVQVKQEPI
ESDDEEAEPPREAEPGQHQPTEQELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFGG
HRPLSRAQSSPASATFPMSVQEPPTKPRFTTGLVYDTLMLKHQCTCGNTNSHPEHAGRIQ
SIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSSLTSVFVR
LPCGGVGVDSDTIWNEVHSSGAARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEEST
PMGFCYFNSVAIAAKLLQQRLNVSKTLIVDWDVHHGNGTQQAFYNDPNVLYISLHRYDDG
NFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPPMGDAEYLAAFRTVVMPIANEFAPDVVL
VSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQLMGLAGGRIILALEGGHDLTAICDASEAC
VSALLGNELDPLPEKVLQQRPNANAVRSMEKVIEIHSQYWRSLRRPSSTAGHSLVEAQKC
ETEEAETVTAMASLSVGVKPAEKR
NT seq 3315 nt NT seq  +upstreamnt  +downstreamnt
atgtattggctagtggaagccacaaagaacgctccaatccccacggatccccagatccca
gtgacgagccacggacaggaccgctttctgagcaccgtgctcctgacgccagcccaggat
ggactttctggccgagaccagccagtggagctgctgaaccctgcccgcgtgaaccacatg
cccagcacagtggacgtggccgcggcgctgcctttgcaagtcgcccccccggcggtgccc
atggacctgcgcctggaccaccagttctcgctgcccgtgacggagcccaccctgcgggag
cagcagctgcagcaggagctcctggccctcaagcagaagcagcagctccagaggcagatc
ctcatcgccgagttccagaggcagcacgagcagctctcgcggcagcacgaggcccagctg
cacgagcacatcaaacaacagcaggagctgctggccatgaagcaccagcaggagctgcta
gagcatcagcggaagctggagagacaccgccaggagcaggagctggagaagcagcaccgc
gagcagaagctgcagcagctcaagaacaaggagaaaggcaaagagagtgccgtggccagc
acggaagtgaagatgaagttacaagagtttgtcctcaacaagaagaaggcgctggcccac
cgcaacctgaaccactgcatttccagcgacccccgctactggtacgggaaaacgcagcac
agttcccttgaccagagctccccgccccagagtggggtgtcggcctcctacaaccacccg
gtcctgggaatgtatgacgccaaagacgacttccctctcagaaaaacagcttctgaaccc
aatctgaagttacggtctaggctaaagcagaaagtggccgagagacggagcagccccctg
ttacgcaggaaagacgggccagtggttactgctctgaaaaagcgtcccctggatgtcaca
gactcggcatgcagcagcgccccgggctcggcacccagctcgcccaacaacagctccggg
aacgtgagcacggagaacgggatcgcgcccgccgtccccagcatcccggccgagaccagc
ttggcgcacagacttgtgactcgggaaggctccgtggctccgcttcccctctacacatca
ccgtccttgcccaacatcaccctgggacttcctgccactggcccttccgctggggcagca
ggccagcaggaagctgagcgactcgctctcccagccctccaacagcggatctccctcttt
cccggcacccacctcacaccatacctgagcacagcgcccctggagcgggacggcgcggcg
gctcacaaccccctcctgcagcacatggtcttactggagcagccgcctgcacagacgccc
ctcgtcacagactggtatctttcaggcctgggagcactgcccctgcacgcgcagtctctg
gttggtgcggaccgggtgtccccgtccatccacaagctgcggcagcaccgcccgctgggg
cgcacgcagtcggccccactgccccagaacgcgcaggccctgcagcacctggtgatccag
cagcagcatcagcagttcctggagaagcacaagcagcagttccagcagcagcagctgcac
atgaacaagattatccccaagcccagcgagccggcccggcagcccgagagccaccctgag
gagacggaggaggagctccgcgagcaccaggccctcctggaggagccctaccgggaccgg
ctctccgggcagaaggaggcgcacgcactgaccggagtgcaggtgaagcaggagcccatc
gagagtgacgatgaggaggccgagcccccgcgggaggcggagccgggccagcaccagcct
acggagcaggagctgctcttcagacagcaagccctcctcctggagcagcagcgcatccac
cagctgaggaactaccaggcgtccatggaggccgctggcatccccgtgtcctttggcggc
caccggcctctgtcccgggcacagtcgtctccagcgtctgccaccttccccatgtctgtg
caggagccccccaccaagccgaggttcaccacaggcctggtgtacgacacgctgatgctg
aagcaccagtgcacctgcgggaacactaacagccacccggagcacgccgggaggatccag
agcatctggtcccggctgcaggagaccggcctccgaggcaaatgtgagtgcatccgtgga
cggaaggccaccttggaggagctgcagacggtgcattcagaggcgcacaccctgctctac
ggcacaaaccccctcaacaggcagaaactggacagctcactgacttcggtgtttgtcagg
ctgccctgtggtggtgtcggggtggacagcgacaccatatggaacgaggtgcactcgtca
ggggcagcccgcctggccgtgggctgcgtggtggagctggtcttcaaggtggccacgggg
gagctgaagaatggctttgccgtggtccgccccccgggacatcacgcagaagagagcaca
cccatggggttctgctacttcaactctgtggccatcgcagccaagcttctccagcaaagg
ctgaacgtgagcaagaccctcatcgtggactgggacgtgcaccacggaaatgggacccag
caggcattctacaacgacccaaatgtcctgtacatctccctacaccgctacgacgacggg
aacttcttcccgggcagcggggcgcctgacgaggtgggcacagggccgggcgtgggcttc
aacgtcaacatggctttcaccggcggcctcgacccccccatgggagatgcggagtacctg
gcggccttcagaacggtggtcatgcccatcgcgaacgagtttgccccggacgtggtgctg
gtgtcatcaggcttcgacgctgtggagggccaccccacgccgctcggcggctacaacctc
tcagccaaatgtttcgggtacctgacgaagcagctgatgggcttggctggcggccggatt
attctggccctggaggggggccacgacctcacggccatttgcgacgcctcggaagcatgt
gtttctgctttgctgggaaacgagcttgatcctctcccagaaaaggttttacagcagaga
cccaatgctaacgctgtccggtccatggagaaggtcattgaaatccacagccagtactgg
cgctcgctgcggcggccctcctccacggcggggcactcgctcgtcgaggcccagaagtgc
gagaccgaggaagccgagaccgtcaccgccatggcctcgctgtccgtgggcgtgaagccg
gccgagaagaggtga

DBGET integrated database retrieval system