KEGG   Equus przewalskii (Przewalski's horse): 103556577
Entry
103556577         CDS       T04644                                 

Gene name
IL3
Definition
(RefSeq) interleukin 3
  KO
K04736  interleukin 3
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04060  Cytokine-cytokine receptor interaction
epz04151  PI3K-Akt signaling pathway
epz04210  Apoptosis
epz04630  JAK-STAT signaling pathway
epz04640  Hematopoietic cell lineage
epz04664  Fc epsilon RI signaling pathway
epz05200  Pathways in cancer
epz05202  Transcriptional misregulation in cancer
epz05221  Acute myeloid leukemia
epz05310  Asthma
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103556577 (IL3)
   04151 PI3K-Akt signaling pathway
    103556577 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103556577 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103556577 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103556577 (IL3)
   04664 Fc epsilon RI signaling pathway
    103556577 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103556577 (IL3)
   05202 Transcriptional misregulation in cancer
    103556577 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    103556577 (IL3)
  09163 Immune disease
   05310 Asthma
    103556577 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:epz04052]
    103556577 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:epz00536]
    103556577 (IL3)
Cytokines and growth factors [BR:epz04052]
 Cytokines
  Interleukins
   103556577 (IL3)
Glycosaminoglycan binding proteins [BR:epz00536]
 Heparan sulfate / Haparin
  Cytokines
   103556577 (IL3)
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 103556577
NCBI-ProteinID: XP_008526960
LinkDB
Position
Un
AA seq 140 aa
MSSLPILHLLLLLFTLHAPQAHGRPSPTLWENLIKEIMKDLNTTPLPPQDNLNPNEIQIL
GETTLLRPNLDAFCRAVPSFKDRVQIGKNLKELQSYLPTPMPMETDWERSISIKKDSWGD
FQKKLIRYLETLENFLRNKH
NT seq 423 nt   +upstreamnt  +downstreamnt
atgagcagcctccccattctgcaccttctcctgctcctgttcacactccatgctccccag
gcgcacgggaggccctccccgacactctgggaaaacctgatcaaagaaattatgaaggat
ctaaacacgacacctttgcctccacaagacaacttgaatccaaatgagatacagatcctc
ggggaaacgacccttctgaggccaaacctggatgcattctgcagagctgtccctagtttc
aaggatagagtacaaattgggaaaaatcttaaggaattacagtcatacctgcctaccccc
atgcccatggagacagattgggaacgctcaattagcatcaagaaggatagctggggtgat
ttccagaagaaattgataagatatctggaaacccttgagaactttctgagaaacaaacac
tga

DBGET integrated database retrieval system