KEGG   Equus przewalskii (Przewalski's horse): 103556824Help
Entry
103556824         CDS       T04644                                 

Gene name
SUV39H2
Definition
(RefSeq) suppressor of variegation 3-9 homolog 2
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:epz00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    103556824 (SUV39H2)
Enzymes [BR:epz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103556824 (SUV39H2)
Chromosome and associated proteins [BR:epz03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103556824 (SUV39H2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    103556824 (SUV39H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 103556824
NCBI-ProteinID: XP_008527343
LinkDB All DBs
Position
Un
AA seq 426 aa AA seqDB search
MVGMANKYTLGRYPTGACFARDLHNEAWCVPCLVSLDTLQELCRKEKLTCKSIGITKRNL
NNYEVEYLCDYKVVKDMEYYLVKWKGWPDSTNTWEPLQNLKCPLLLQQFLNDKRNYLSQV
KKGRAITLKDNNKALKPAIAEYIVKKAKQRIALQRWQDELNRKKNHKGMIFVENTVDLEG
PPSDFYYVNEYKPAPGISLVNEATFGCSCTDCFFEKCCPAEAGVLLAYNKNRQIKIPPGT
PIYECNSRCQCGPDCPNRIVQKGTQYSLCIFRTSNGCGWGVKTLVKIKRMSFVMEYVGEV
ITSEEAERRGQLYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFI
DNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVT
CRGYLN
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggtgggaatggcaaacaagtacaccttgggtagataccccacaggagcctgctttgca
cgtgatctgcataatgaggcttggtgtgtgccttgcctagtttcacttgatactcttcag
gaattatgtagaaaagaaaagctcacatgtaaatcgattggaatcaccaaaaggaatcta
aacaattatgaggtggaatacttgtgtgactacaaggtagtaaaggatatggaatattat
cttgtaaaatggaaaggatggccagattctacaaatacttgggaacctttgcaaaatctc
aagtgcccattactacttcagcaattccttaatgacaagcgtaattatttatctcaggta
aagaaaggcagagcaataactctaaaagacaataacaaagctttgaaacctgccattgct
gaatacattgtaaagaaggctaaacaaaggatagctctgcagagatggcaagatgaactc
aacagaaaaaagaatcataaaggaatgatttttgttgaaaatactgttgacttagagggc
ccaccttcagacttctactacgttaatgaatacaaaccagctcctggaatcagcttagta
aatgaagctacatttggttgttcgtgcacagattgcttctttgagaaatgttgtcctgct
gaagctggagttcttttggcttataataaaaaccgacaaattaaaatcccacctggtacc
cccatttatgaatgcaactcaaggtgtcaatgtggacctgattgtcccaataggattgta
caaaaaggcacacagtattcactttgcatctttcgaactagcaatggctgtggctggggt
gtaaaaacccttgtgaagattaaaagaatgagttttgtcatggaatatgttggagaggta
atcacaagtgaagaagctgaaagacgggggcagttatatgacaacaaaggaatcacatat
ctctttgatctggactatgaatctgatgaattcacagtggatgcagctcgatatggaaat
gtgtctcattttgtgaatcacagttgtgacccaaatcttcaggtgttcaatgttttcatt
gataacctcgatactcgtcttccccgaatagcattattttccacgagaaccataaatgcc
ggagaagagctcacttttgattatcagatgaaaggttctggagatatatcttcagattct
attgaccacagcccagccaaaaagagggtcagaactgtgtgcaaatgtggagctgtgact
tgcagaggttacctcaactga

DBGET integrated database retrieval system