KEGG   Equus przewalskii (Przewalski's horse): 103557351
Entry
103557351         CDS       T04644                                 

Gene name
RASSF1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04014  Ras signaling pathway
epz04390  Hippo signaling pathway
epz04392  Hippo signaling pathway - multiple species
epz05200  Pathways in cancer
epz05206  MicroRNAs in cancer
epz05219  Bladder cancer
epz05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103557351 (RASSF1)
   04390 Hippo signaling pathway
    103557351 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    103557351 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103557351 (RASSF1)
   05206 MicroRNAs in cancer
    103557351 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    103557351 (RASSF1)
   05223 Non-small cell lung cancer
    103557351 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH
Other DBs
NCBI-GeneID: 103557351
NCBI-ProteinID: XP_008528055
LinkDB
Position
Un
AA seq 329 aa
MGTGAGAGHKRVLTVEARTLVPAHAHTDTRAHAHTRLGRWLEATGSHDSGSWRAGAAMGE
ADAGTPSFEMTWSSTTSSGYCSQEDSDSELEQYFTARTSLARRPRRDQDEPVEWETPDLS
QAEIEQKIKEYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQDARRG
PGRGTAVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERAERH
GQVYLRKLSDDEQPLRLRLLAGPNEKALSFVLKENDSGEVNWDAFSMPELHNFLRILQRE
EEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 990 nt   +upstreamnt  +downstreamnt
atgggaaccggcgctggagcgggacacaaacgtgtgttaacggttgaggcacggacactg
gtcccggcgcacgcgcacactgacacgcgcgcgcacgcgcacacgcgcctggggcggtgg
ttggaggctaccggctcacacgactcagggagctggcgggcgggcgcggcaatgggcgag
gcggacgcagggacgccttctttcgagatgacctggagcagcacgacaagcagtggctac
tgcagccaggaggactcggactcggagctcgagcagtacttcacggcgcgtacctcgctg
gcgcggaggccgcgccgggaccaggacgagcctgtggagtgggagacacctgacctttct
caggctgagattgagcagaagatcaaggagtacaatggccagatcaacagcaacctcttc
atgagcctgaacaaggatggctcctacacaggcttcatcaaggttcaactgaagctagtg
cgccctgtctcagtgccctccagcaagaagccaccctccttgcaggatgcccggcggggc
ccagggcgtggcacagctgtgaggcgccgcacttccttctacctccccaaggatgctgtc
aagcacctgcatgtgctgtcacgcacacgggcacgcgaggtcattgaggctctgctgcgc
aagttcttggtggtagatgacccccgcaagtttgcactctttgagcgggctgagcgccat
ggccaagtgtacctccggaagctgtctgatgatgagcagcccctgcgactgcggctcctt
gcagggcccaatgagaaagccctaagctttgtcctgaaggagaatgactctggggaggtg
aactgggatgccttcagcatgcctgaactacacaacttcctacgcatcctgcagcgggag
gaagaagaacacctccgccagatcctgcagaagtactcctattgtcgccagaagatccag
gaggccctgcatgcctgccccctggggtga

DBGET integrated database retrieval system