KEGG   Equus przewalskii (Przewalski's horse): 103557874
Entry
103557874         CDS       T04644                                 

Gene name
IL2
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04060  Cytokine-cytokine receptor interaction
epz04061  Viral protein interaction with cytokine and cytokine receptor
epz04151  PI3K-Akt signaling pathway
epz04625  C-type lectin receptor signaling pathway
epz04630  JAK-STAT signaling pathway
epz04658  Th1 and Th2 cell differentiation
epz04659  Th17 cell differentiation
epz04660  T cell receptor signaling pathway
epz04672  Intestinal immune network for IgA production
epz04940  Type I diabetes mellitus
epz05135  Yersinia infection
epz05142  Chagas disease
epz05162  Measles
epz05166  Human T-cell leukemia virus 1 infection
epz05200  Pathways in cancer
epz05320  Autoimmune thyroid disease
epz05321  Inflammatory bowel disease
epz05330  Allograft rejection
epz05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103557874 (IL2)
   04151 PI3K-Akt signaling pathway
    103557874 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103557874 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103557874 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103557874 (IL2)
   04660 T cell receptor signaling pathway
    103557874 (IL2)
   04658 Th1 and Th2 cell differentiation
    103557874 (IL2)
   04659 Th17 cell differentiation
    103557874 (IL2)
   04672 Intestinal immune network for IgA production
    103557874 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103557874 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103557874 (IL2)
   05321 Inflammatory bowel disease
    103557874 (IL2)
   05330 Allograft rejection
    103557874 (IL2)
   05332 Graft-versus-host disease
    103557874 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103557874 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103557874 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103557874 (IL2)
   05162 Measles
    103557874 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    103557874 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:epz04052]
    103557874 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:epz00536]
    103557874 (IL2)
Cytokines and growth factors [BR:epz04052]
 Cytokines
  Interleukins
   103557874 (IL2)
Glycosaminoglycan binding proteins [BR:epz00536]
 Heparan sulfate / Haparin
  Cytokines
   103557874 (IL2)
SSDB
Motif
Pfam: IL2
Other DBs
NCBI-GeneID: 103557874
NCBI-ProteinID: XP_008528829
LinkDB
Position
Un
AA seq 149 aa
MYKMQLLACIALTLAVLANSAPTSSSKRETQQQLKQLQMDLKLLLEGVNNNKNPKLSKML
TFKINMPKKATELKHLQCLEEELKPLEEMLKNFLSKDIKELMSNINVTVLGLKGSETRFT
CEYDDETGTIVEFLNKWITFCQSIFSTMT
NT seq 450 nt   +upstreamnt  +downstreamnt
atgtacaagatgcaactcttggcttgcatcgcactaactcttgcagtccttgcaaacagt
gcacctacttcaagctctaagagggaaacacagcaacaactgaagcaattacagatggat
ttaaagttgcttttggaaggagttaataataacaagaatcccaaactctccaagatgctc
acatttaaaattaacatgcccaagaaggccacagaattgaaacatcttcagtgtctagaa
gaagaactcaaacctctggaggaaatgctaaaaaactttctctcgaaagatatcaaggaa
ttaatgagcaatatcaatgtaacagttctgggactaaaggggtctgaaacaagattcaca
tgtgaatatgatgatgagacaggaacaattgtagaatttctgaacaaatggattaccttt
tgtcaaagcatcttctcaacaatgacttga

DBGET integrated database retrieval system