KEGG   Equus przewalskii (Przewalski's horse): 103558173Help
Entry
103558173         CDS       T04644                                 

Gene name
MBD4
Definition
(RefSeq) methyl-CpG binding domain 4, DNA glycosylase
  KO
K10801  methyl-CpG-binding domain protein 4 [EC:3.2.2.-]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:epz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    103558173 (MBD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:epz03036]
    103558173 (MBD4)
   03400 DNA repair and recombination proteins [BR:epz03400]
    103558173 (MBD4)
Enzymes [BR:epz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     103558173 (MBD4)
Chromosome and associated proteins [BR:epz03036]
 Eukaryotic type
  Heterochromatin formation proteins
   MBPs (metylated DNA binding proteins)
    103558173 (MBD4)
DNA repair and recombination proteins [BR:epz03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     103558173 (MBD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MBD HhH-GPD
Motif
Other DBs
NCBI-GeneID: 103558173
NCBI-ProteinID: XP_008529236
LinkDB All DBs
Position
Un
AA seq 707 aa AA seqDB search
METPSLGDCGAAPSVSSSERLLPARPCDLRKEDVAPGSETVGKDEKQMVIKSSSECNPLL
QEPIASAQFGDTAVTECHKPVPCGWERVVKQRLSGKTAGRYNVYFISPQGLKFRSKISLA
NYLHKNGENSLKPEDFDFTVLSKRGIKSRYKDRSVAALPSQLQNESNSSNRNLRTRSRWK
KDVLPLPSGSLELQDSRGLSNFTSIPLPPKEDEDVNDADSRKVRKSKGKVTILKGIQIKK
TKTGCRKSPSASVRSNRKRESGYNKADAESEPVVQESQLDRTFCISDATASNKTLSVTSE
EKRLVEETSLSSESDFHFEQITSGVINKLRSAKEAEPNKKCEDAFLESEEITKVDAGERR
EHLHMDILKCGSEMNNCLQTKKDSTSLKIFQEDTISQTQREKRKTSLYFSRKYNKEGLSP
PRRKAFKKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWEFLEKYPSAE
VARTADWRDVSELLKPLGLYDLRAKTIIRFSDEYLTKQWRYPIELHGIGKYGNDSYRIFC
INEWKQVRPTPSHYISSTFLHILSLRQSQSTVLAKTISWTHVLLVTTNFLPNSRGSGWHG
VIGSRKRIHRQSQVHKDSSVSPLHDLQWFVTSGPLLVIPIHTLSLSLTWISFCHSHTSLP
KYTTEGKRANWGLEDRLVGFLLVASDYFCLGPTSSAHSIKYAQPTGT
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggagactccgagcctgggggactgcggagctgccccctcggtcagctccagtgagcgc
ctactcccagcccggccttgtgacctccgcaaggaagatgttgctccgggatcagagaca
gtgggaaaagatgagaaacaaatggtgataaaaagcagcagtgagtgtaatcccctgcta
caggaacccattgcttctgctcagtttggtgatactgcagtgacggaatgccataagcct
gtcccatgcggatgggaaagagttgtgaagcaaaggttatctgggaaaacagcaggaaga
tataatgtatattttatcagcccacagggactgaagttcagatccaaaatttcacttgct
aattatcttcacaaaaatggagagaattctcttaagccagaagattttgattttaccgta
ctttctaaaaggggcatcaagtcaaggtataaagaccgcagcgtggcagctttgccatcc
caactgcaaaacgaaagtaacagttcaaaccggaacctcaggactcgaagcaggtggaaa
aaagatgtgcttcctctgccaagtggtagtttggaattacaggatagcagaggactatct
aactttacttccattcctttgcctccgaaagaagatgaggatgttaatgatgctgactcc
agaaaggttagaaagtccaaaggaaaggtgactattttgaaaggaattcagattaagaaa
actaaaacaggctgccggaagagtccttcagcttctgttcgaagtaatagaaaaagagaa
tctgggtataataaggcagatgctgaaagtgaacctgttgtgcaagaaagtcagcttgat
agaactttctgcatttctgatgccacagcaagcaacaagaccctcagtgtgaccagtgaa
gaaaagagacttgtagaagaaacatcattgagttcagaatcagattttcattttgaacaa
ataacttctggtgtcataaacaaattacgttcagccaaagaagcagaacccaacaagaag
tgcgaggatgcctttttagaatctgaggaaataacaaaagtagatgctggggaaaggagg
gaacatttgcatatggacattttaaaatgtggctctgaaatgaacaactgcttacaaacc
aagaaagactctacttctttgaaaatatttcaagaagacaccatctcacagacacaaaga
gaaaaaaggaaaacaagcctgtatttttccagaaaatataacaaagaaggtcttagcccc
ccacgacgcaaagcctttaagaagtggacaccccctcggtcaccttttaatctcgtccaa
gaaacactttttcacgatccatggaagctcctcattgcaacaatatttctcaatcggacc
tcaggcaaaatggcaattcctgtactttgggagtttctggagaagtatccttcagctgag
gtggcaagaaccgcagactggagagatgtgtcagaacttcttaaacctcttggtctctac
gatcttcgagcaaaaaccattatcaggttctcagatgaatatctgacaaagcagtggagg
tatccgattgagcttcatgggattggcaaatatggcaatgactcttaccgaattttttgc
atcaatgaatggaagcaggtaaggcccactcccagccattacatctccagcacatttttg
cacattttgtctctgaggcaaagtcagtccactgttttggctaaaactatttcttggaca
cacgtgctattagtcacaaccaattttcttccaaactcgaggggcagtgggtggcatggg
gttattggcagcaggaagaggatccataggcaatcccaagtccataaagactcctcagtg
tcacctctccatgacctccagtggtttgtcacttctggccctcttcttgtcattcctatt
catacactctctctaagtctgacatggatttccttctgtcacagtcatactagccttcca
aagtacactactgaaggaaagagggcaaactggggcttggaagacaggcttgttggcttt
ctcctagtggcctcagactatttttgtctggggcctacttcatctgcccattctattaag
tatgcccagcccacaggcacctag

DBGET integrated database retrieval system