KEGG   Equus przewalskii (Przewalski's horse): 103558278Help
Entry
103558278         CDS       T04644                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00052  Galactose metabolism
epz00500  Starch and sucrose metabolism
epz01100  Metabolic pathways
epz04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103558278
   00500 Starch and sucrose metabolism
    103558278
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103558278
Enzymes [BR:epz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     103558278
    3.2.1.20  alpha-glucosidase
     103558278
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 103558278
NCBI-ProteinID: XP_008529405
LinkDB All DBs
Position
Un
AA seq 2569 aa AA seqDB search
MARKLTVLEVLLIVFIIIILALDILLLLLVLENPSDLPVCPEIPESERIDCAPGQVVTEA
VCRWQHKCCWKPGSDADVPTCFFPRNWGYNVSNDYKNTSAGFTAQLKRLSSPSLFGYDIV
DTLFTAEYQTANRFHFKITDFNNMRYEVPHENIQLFNETVDTSNLSYHIEVTHIPFSIKI
MRTSNKRVLLDTSIGPLLFAQQYLQLSFRLPSANVYGLGEHVHQQYRHNMTWKTWPIFTR
DATPTEGMNNLYGAHTFFLCLEDTSGSSFGVFLLNSNAMEVTLQPAPAITYRTTGGILDF
YVFLGNTPEQVVQEYLELVGRPFLPSYWSLGFQLSRRNYGGINGLKEVVARNRAAGIPYD
VQYSDIDYMDGKKDFTIDEEAFPGLSNFIKDLHSNGMKYVIAVNPGISNNSDYLPYVNGT
KKRVWILDDNGFVTGQGYPGWTVFPDYSNPICTEWWTEEFSEFHKTLEFDGVWIEMDEVS
SFLQGSDHECESNNLNFPPFTPRVLDHFLFARTLCMDTVFHSGLHYDVHSLYGYSMARAT
DSAMENVFPNKRNFILSRSTFAGSGKFVAHWLGDNAATWDDLRWSIPSILEFNLFGIPLV
GANICGYREDVSEELCRRWMQLGAFYPLSRNHNGPEFRDQDPAAFGENSQLLNSSRHYLN
IRYTLLPYLYSLFYRAHTLGETVARPLVHEFYQDPATWEVHEQFLWGPGLLITPVLYEGV
TQVKAYIPDAIWYNYETGVAIQWRKQLVEMLLSDEKIGLHLRGGYIFPTQQPNTTTENSR
KNSLGLIIALDYKREAKGELYWDDGVSKDAVTEKNYILYDFSVTSNHLQAKIINDNYTDP
NNLTFTNIAILGMDKQPTNFTVLFNNAATPIPNVVYSASTKVVSITDLEGLVLGREFSIG
WNLPVSDLEKFNCYPEDPSASEESCRQRGCLWEHTTTPGVPTCYYDTIPSYAASNIQYLP
TGITTDLALLTAPESVGAAAPPPPSSRGMPPPPAAAAATADDLSAKIDFLQLSVIYHTEN
MLQFKIYDPRNKRYEVPVPLNTPPSPVGSPENRLYDVRIQNNPFGIQIRRKSSNTVIWDS
QLPGFTFNDMFLSISTRLPSEYIYGFGETEHTAFKRNMSWHMWGMFARDEPPAYKKNSYS
VHPYYMALEEDGSAHGVLLLNSNAMDVTFQPTPALTYRTTGGILDFYMFLGPTPELVTQQ
YTELVGRPAMIPYWALGFQLSRYGYQNDTEISNLYDAMMAAQIPYDVQHVDIDYMDRKLD
FTLSSSFQNLGLLIEQMKKDGMRFILILDPAISGNETQYLTFTRGQENNVFIKWPDNSDI
VWGKVWPDLPNVIVDGSLDQETQVELYRAYVAFPDFLRNSTATWWKKEIEELYTNPREPE
KSLKFDGLWIDMNEPSNFVDGSVWGCRDETLNNPPYVPYLESRNKGLSSKTLCMESQQVL
PDGSLVRHYDVHSLYGWSQTRPTYEAVQEVTGQRGVIITRSTFPSSGRWGGHWLGDNTAA
WDQLKKSIIGMMEFSLFGISYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNHNTFGTR
RQDPVAWNSTFEMISRNVLQTRYTLLPYLYTLMHKAHVEGSTVVRPLLHEFTVDNKTWEI
DDQFMLGPAILISPVLESNTFEIHAYFPSARWYDYSTESGNTATGEWKTLQAPLDHINLH
IRGGYILPWQESAMNTYSSRQKFMGLIVALDDNGKAEGEMFWDDGQSIDTYENGNYFLAK
FTAAQNILEIQTIHNKYLSDLNPLKVGYIRIWGINSMFVTQVTFTYDNQQFMETNFKSDP
YTQTLTIQLTDKDISLEKLTEITWMYGDPIVFTTPVTSTFPMSSLHPSTSTTKATTSETI
ITSSASTSTPAARTTTTLPITTPPFPTSTMEVTTSATVPITTVPSSTNSPTARTTATLPI
TTPPFPTRTMEVTTSTTVPITTMPSSTNIPTARTTTPLPITATPFPTSAIEVTTSATVPI
TTIPSPTNTPTTRTTATLPITTPPFPTSAIEVTTGTTVPITTVPSPTNTPTTRTTATLPI
TTPPFPTRTMEVTTSTTVPITTMPSSTNIPTARTTTPLPITATPFPTSAIEVTTGTTVPI
TTMPSPTNTPTVSGTSNTISVTTTSFQTPPTTLIHTLISTPNSTPPSLSTFPTSKTFTTD
LITDFTTPTNADTTHLNTMDTQGTMMMDAIVATTSTTNNTRSPDTSKDKFTAHTQPATTD
FISIFPPEEITAASLSTINTAMLTSTNLGSGTSPVVTSSINSLTTDGTTVSTLKSADTTI
AIATVTDTLVSATQDLIHFPPSTEDVKTATTDITQLTTPHSSPTTTQTLSHTTLISTNFS
NPASVNATNTSTTSITMDSVTRNILDSTISRNTNTNTGFTTVTMITNATPVETTTQVTSA
LPPTGTHGATTTENESLMGLTRIITMTNPPHIPTNALNTTSIGTGNSTIPSTTNVNITNK
ITGVTNIISTPTRDSPTTVDGSMTTILTNTTDIESTTKATGNAIIAYTTTITTHISSTKT
TNSMNTSDTVLTNTSIPSTTAVSSTNTINSTGHEVNITDADNVSSVSAF
NT seq 7710 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaagctcactgtattggaagtccttctgattgtcttcatcataatcatactt
gccttagatatcctcctgctgcttcttgtgttggagaatccttcagatcttccagtgtgc
ccagagatccctgaatcagaaaggatagactgtgcgcctggccaggtggtgacagaggct
gtctgcagatggcaacataaatgctgctggaagcctgggtcagatgctgatgtccctaca
tgcttcttccccaggaactggggctataatgtcagcaatgactataaaaatacaagcgca
gggtttactgcccagttgaaaaggttgtcatccccatctctgtttggatatgatatcgtc
gacaccctcttcacagctgaatatcagacagccaatcgttttcatttcaagatcactgat
ttcaataacatgcgctatgaagtcccccatgaaaatattcagctgtttaatgagactgtt
gatacctccaatttgagctatcacatagaggtcactcatatacccttcagcatcaaaata
atgaggacgagcaataaaagagtcttgttggacacgagcattgggcccctcctgtttgcc
cagcagtacctgcagctgtctttccgactgcccagcgccaatgtgtatgggctgggggaa
catgtgcaccagcagtaccgtcacaacatgacctggaagacctggcccatcttcacccgg
gatgccacccccactgagggcatgaataatctgtatggagctcatacattcttcttgtgc
cttgaagacaccagcggctcctcttttggggtttttctgttgaacagcaatgctatggag
gtcacccttcagcccgcccctgcaatcacttaccgcaccactgggggcattcttgacttt
tatgtgttcctgggaaacactccagaacaagtggtgcaggaatacctggagcttgttgga
cgaccattcttgccttcatactggagtcttggattccagcttagtcgcagaaattatggt
ggcatcaacggattgaaagaggttgtagctcgaaatcgtgcagctgggatcccatatgat
gtccagtattctgacatagactacatggatggaaagaaggatttcactattgatgaagag
gcgttccctggtctctcaaattttatcaaagacttacatagcaatggaatgaaatatgta
attgctgtgaatcctggcatctcaaataactctgactacctgccctatgtgaatgggaca
aaaaagagagtatggatcttggatgacaatggctttgtcactgggcagggatatcccgga
tggacagtctttcccgattatagtaatccaatttgtactgagtggtggacagaggagttc
agtgaatttcataaaactctggagtttgatggagtctggattgaaatggatgaagtatct
agttttctccaaggttctgatcatgagtgtgaatcaaacaacttgaactttcctcctttc
actcctcgagtcctggaccacttcctttttgcaagaaccctctgcatggacacggtgttt
cactcgggccttcactatgatgtccacagcttgtatggctactccatggcaagagccaca
gactcggccatggagaatgtcttccccaataaaaggaacttcattttatcccgttctact
tttgctggatctggcaaatttgttgctcattggttgggggacaatgcagccacatgggat
gatctccgatggtccatccccagtatccttgagttcaacctatttggcatccccctggta
ggtgccaacatctgtggttatagagaagatgtttcagaagaactctgcagaaggtggatg
cagcttggagcattttatccactatcaaggaatcataatgggcctgagttcagggaccag
gatcctgcagcctttggtgaaaactctcagctgttgaattcctccagacactatctgaac
atccggtacaccctgctgccttatctctacagcctcttctaccgcgctcataccctgggg
gagactgtagcaaggccccttgttcatgagttctaccaggacccagctacatgggaggtg
cacgagcagttcttatgggggcctggactcctcatcacgcctgttctatatgaaggtgtg
acccaagtgaaagcatacatacctgatgccatctggtataactatgagacgggagtagcc
atccaatggaggaaacaattggtggagatgctactgtcagatgaaaagataggacttcac
cttcgagggggctacatatttcccacccagcagccaaacacaaccacagagaacagtcgg
aagaattcccttggactcattattgctttggactataagagagaagcaaagggggaactc
tactgggatgatggtgtatctaaagatgctgtcactgaaaagaattatattttgtatgat
ttttccgtcacctctaaccatctacaggcaaagattataaatgataattatacggatcct
aacaacctcacgtttacaaatatcgcaatcttgggaatggacaagcaacctactaatttt
actgtcttatttaataatgctgccacccccattccaaatgttgtctacagtgcttcaaca
aaggtggtgagcatcactgatcttgagggactggtactgggacgagaattctccatcggg
tggaatcttccagtcagtgacctggagaagttcaactgttaccctgaggaccccagtgcc
tccgaggagagttgtaggcagcgggggtgcctttgggagcacacaactactcctggtgtg
cccacctgttactacgacaccatccctagttatgcagccagtaacattcagtacctgccc
acgggcatcaccacagaccttgccctcttgacagctcccgagtcagtgggagcagcggca
ccaccaccaccatcatcacgaggtatgccacccccacctgcagcagcagcagccaccgct
gatgatctctctgcaaagattgacttcctccaattgagcgtcatctaccacacagaaaac
atgctgcagttcaagatctatgaccccaggaataaaaggtatgaggtcccagtgcctctg
aacacccctccctctccagttggctcccctgaaaaccgtctgtatgatgtcaggattcag
aacaatcctttcgggatccagattcgacgaaaaagctccaatactgtgatctgggattct
cagctccccggcttcaccttcaatgatatgttcctgtccatttctactcgcctcccttct
gagtacatctatggctttggggaaactgagcacacagctttcaaaagaaacatgagctgg
cacatgtggggaatgtttgctcgagatgagccaccagcgtacaagaagaattcctatagt
gtccacccctactatatggcactggaggaggatggcagtgcccatggagtgctcctgcta
aacagcaatgccatggatgtgacattccagcccactcctgccctgacgtaccgcaccaca
ggagggattttggacttttatatgtttttgggaccaactccggagcttgtaactcagcaa
tacactgagttggtcggtcggccggcaatgattccttactgggccttgggattccagctg
agtcgctatggataccagaatgatactgaaatctccaatttgtatgatgcaatgatggca
gcccagattccctatgatgtccagcatgtagacatcgattacatggaccggaagctggac
ttcactctcagctccagctttcaaaaccttggtctcctgattgagcaaatgaagaaagat
ggcatgagatttattctcattctggacccagccatttctggcaatgagacccagtatctc
acattcaccagagggcaggaaaacaacgtattcatcaaatggcctgacaacagtgatatt
gtctggggaaaggtttggccagatctgcccaatgtgattgtggatggatcccttgaccag
gaaactcaggttgagctgtacagagcctacgttgcttttcctgatttcttgcgtaatagc
acagccacatggtggaagaaggaaatagaagagctctatacaaaccctcgagagccagaa
aagagcttgaagtttgatggattgtggattgatatgaatgaaccatcgaactttgtggat
ggatctgtctggggctgcagagatgaaactcttaataatccaccctatgtgccgtatctg
gagtccaggaacaagggtctgagcagcaaaaccctgtgcatggagagtcagcaggtcctg
ccagatggctccctggtgcggcactacgatgtgcacagcctgtacgggtggtcccagacc
agacccacatacgaagctgtgcaggaggtgacaggacagcgaggggtcatcatcacccgc
tctactttcccctcttctggccgctggggaggacactggctgggagacaacacggctgca
tgggaccagctgaagaaatctatcattggcatgatggagttcagtctctttggaatatct
tatacgggagcagatatttgtgggttctttggagatgctgaatatgagatgtgtgtccgt
tggatgcaactgggggcattttatccattttccaggaaccacaacacattcgggacaagg
agacaagatcctgtggcctggaattcaacctttgagatgatctcaagaaacgtcctccag
accagatacaccctgctaccttacctctatactctgatgcataaagctcacgttgagggc
agcactgttgtccgaccccttctccatgagtttacagttgacaacaaaacgtgggaaata
gacgatcagttcatgttgggacccgccatcttaatcagccccgtgctagaaagtaacact
tttgagatccatgcttattttcccagtgctcgttggtatgactatagcacggaatctggc
aatacagccacaggtgagtggaaaaccctgcaggctccccttgatcacatcaaccttcac
atcagaggaggctacatcctgccttggcaagagtctgcaatgaacacttactccagtcga
caaaaatttatgggattgattgttgctttggatgacaatgggaaagccgaaggtgagatg
ttctgggatgatggacaaagcattgatacctatgaaaatggaaactatttcttggcaaag
tttacagcagctcagaacatattggaaattcagaccatacacaataagtatttgagtgac
ttgaatccactgaaagttggatatattcgaatctgggggataaactctatgtttgtgaca
caagtgaccttcacctatgacaaccagcaattcatggagacaaatttcaagagtgaccct
tacactcagacactaactattcaattgactgacaaggatatcagcctggaaaagttaact
gaaattacttggatgtatggtgatcctatagtttttactacacccgtgacaagtaccttc
ccaatgagttctctacatccttctacatctactactaaggctaccacttctgagactatt
atcactagttctgctagtacaagtactcctgctgctaggactactactactcttcctatc
acaacccctcctttcccaacaagtactatggaagttacaactagtgctactgttcctatt
accactgtgccttcctcaacaaattctcctactgctaggactactgctactcttcctatc
acaacccctcctttcccaacaagaactatggaagttacaactagtactactgttcctatt
accactatgccttcatcaacaaatattcctactgctaggactactactcctcttcctatc
acagccactcctttcccaacaagtgccattgaagttacaactagtgctactgttcctatt
accactatcccttccccaacaaatactcctactactaggactactgctactcttcctatc
acaacccctcctttcccaacaagtgctattgaagtgacaactggtaccactgttcctatt
accactgtgccttccccaacaaatactcctactactaggactactgctactcttcctatc
acaacccctcctttcccaacaagaactatggaagttacaactagtactactgttcctatt
accactatgccttcatcaacaaatattcctactgctaggactactactcctcttcctatc
acagccactcctttcccaacaagtgccattgaagttacaactggtaccactgttcctatt
actactatgccttccccaacaaatactcctactgttagtggtactagtaatactatttct
gtcacaactacttctttccagactcctcccaccactctaattcatactcttatttctact
cctaactctactcctcctagcttgagcacatttccaaccagtaagacatttactactgat
ttaatcactgattttacaacacctactaacgcagacaccactcatctcaacaccatggat
acacaaggtaccatgatgatggatgctatagttgctactaccagcaccacaaataatacc
aggagtccagatacctccaaagataaattcactgcacatacacaacctgctacaactgat
tttataagcattttccccccagaagaaataactgctgcctcccttagcactattaatact
gcaatgctaacttctacaaatctgggcagtggaacctctcccgtcgtaacaagttcaata
aatagcctcactacagacggtacaacagtaagtacacttaaatctgcagatactaccatt
gctatagcaactgttacagacacattagtctctgctacccaggaccttattcactttccc
ccttccactgaagatgttaaaactgccaccacagacatcacacagctcactactccccat
tcttctcctactacaacacaaactttgagccacacaacgttaatttccacaaatttttct
aatccagcttctgtcaacgctactaacacaagtactacatccataactatggattcagtt
actagaaatattttagatagtaccatttcaagaaacacaaacacaaatacaggcttcacc
acagttactatgattacaaatgctactcctgtagaaactaccactcaggtcacttcagct
ctgcctcctacaggcacccatggtgccaccaccacagaaaatgaatcattaatgggactt
accagaatcattaccatgactaatcctccacatatccctactaatgctttaaataccaca
tccattggcactggaaatagcactataccaagcaccaccaatgtaaatattaccaataaa
ataactggtgttaccaatattataagcactcccactagagatagcccaactactgttgat
ggcagcatgacaactattcttaccaacactacagatattgaatctactactaaagctaca
ggaaatgccattatagcatacaccaccaccatcactacacatatttccagcacaaaaact
acaaattcaatgaatacttctgacacagtccttacaaacacttccattccaagtaccact
gccgtttcctccaccaacactataaacagtacagggcatgaagtaaatattactgatgca
gataatgtcagcagtgtttcagctttttga

DBGET integrated database retrieval system