KEGG   Equus przewalskii (Przewalski's horse): 103558279Help
Entry
103558279         CDS       T04644                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00052  Galactose metabolism
epz00500  Starch and sucrose metabolism
epz01100  Metabolic pathways
epz04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103558279 (MGAM)
   00500 Starch and sucrose metabolism
    103558279 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103558279 (MGAM)
Enzymes [BR:epz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     103558279 (MGAM)
    3.2.1.20  alpha-glucosidase
     103558279 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 Abhydro_lipase
Motif
Other DBs
NCBI-GeneID: 103558279
NCBI-ProteinID: XP_008529406
LinkDB All DBs
Position
Un
AA seq 1797 aa AA seqDB search
MARKKWKNFTTLELMLSALLLVLFIITIPIFVLSARDSLGSEDPGTTVTPDPGTTVTLNP
SSTAIPDHETTTTVPASAECPVVNELERINCIPDQPPTKATCDQRGCCWNPQGPISVPWC
YYSQSHGYQMEDNLVNTNAGFTAQLKRLPSPSLFGNDVNNVLLTAECQTSNRFHFKLTDQ
NQDRYEVPHEHVQSFNGNAASALTYEVTVSKQPFSIKVTRRSNNRVLFDSSIGPLLFADQ
FLQLSIRLPSAIRLPSANVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGDGTNLYGAQT
FFLCLEDASGLSFGVFLLNSNAMEVSLQPAPAVTYRTIGGILDFYVFLGNTPEQVVQEYL
ELIGRPALPSYWALGFHLSRYDYGSLDNMKEVVERNRAAQLPYDVQHADIDYMDERKDFT
YNPVDFKDFPEFAKELHNNGQKLIIIVDPAISNNSSPSQPYGPYDRGSDMKIWVNASNGV
TPLIGEVWPGKTVFPDYTNPQCAVWWAREFELFHNQVDFDGIWIDMNEVSNFIDGSVSGC
SVHLELWLTDPSFVPGVLDGYLFSKTLCMDAVQYWGKQYDVHNVYGYSMAIATAEAVNTV
FPSKRSFILTRSTFAGSGKFAAHWLGDNTATWNDLRWSIPGILEFNLFGIPMVGPDICGF
FLDSSEELCRRWMQLGAFYPFSRNHNGQGYKAQDPAFFGADSLLVNSSRHYLTIRYTLLP
YLYTLFYRAHSRGDTVARPLLHEFYGDSSTWDVHQQFLWGPGLLITPVLEEGAEKVMAYM
PDAVWYDYETGGRVRWRKQQVEMDLPGDKIGLHLRGGYIFPTQQPATTTVASRRNPLGLI
ISKEPSWSYHCLRSFRSCKTFVLRINFLVPSPFLQVALITELDLILGEAYTVEWELKVAD
EEKIDCYPDENGVSAENCTARGCVWEESSSPGVPFCYFVSDLYSVSDVQYDTHGATAVIS
LNSSPYAYALPSIPVNSLHLNVTYHKNDMLQFKIYDPNNNRYEVPVPLNIPQVPSSTSES
RLYDVLIKKNPFGIEIRRKSTGTVIWDSQLLGFTFNDMFIRISTRLPSRYLYGFGENEHT
AFRRDLNWHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVLLLNSNAMDVTFQPL
PALTYRTTGGILDFYVFLGPTPEIVTQQYTELIGRPVMVPYWSLGFQLCRYGYENDTEIA
NLYDDMVAAQIPYDVQYSDIDYMERQMDFTLSPKFAGFPDLITRMHADGMRVILILDPAI
SGNETQPYPAFTRGVEDDVFIKAPGGGGIVWGKVWPDFPDVVVNDSLDWDTQVELYRAYT
AFPDFFRNSTVKWWKREFEELYSNPQNPEKSLKFDGMWIDMNEPASFVNGAVPPGCMNAT
LNHPPYMPYLESRDSGLSSKTLCMESEQILPDGSRVRHYDVHSLYGWSQTRPTYEAVQEV
TGQRGIVITRSTFPSSGRWAGHWLGDNTAAWDQLRKSIIGMMEFSLFGISYTGADICGFF
QDAEYEMCARWMQLGAFYPFSRNHNTIGTRRQDPVSWDATFVNISKTVLQTRYTLLPYLY
TLMHLAHTEGSTVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLEPNARNVTAYFPRA
RWYDYYTGEDIKARGEWKSLPAPLDHINLHVRGGYILPWQEPAQNTHLSRQKFIGFKVAL
DDDGTAEGCLFWDDGQSIDTYEKGLYYLANFSASQNTMQSHVIFNQYIVDTNPLKLGYIE
IWGVGSAPVSNVSVSLSSTVITPAFTYNPTTQVLNIDVTSRDISLHNFISLTWSSTL
NT seq 5394 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagtggaaaaatttcactactttggagcttatgctcagcgcacttctg
cttgtgttatttatcatcactattcctatatttgtgctgtcagctagagattctttggga
tcagaagatcctgggacgacagtgaccccagatcctgggacgacagttaccctcaatcct
agttcgacagctatcccagatcatgagacaacaactaccgtccctgcttctgcagagtgc
ccagtggtgaatgaattggaacggataaactgcatccctgaccagccaccaacaaaggcc
acatgtgaccagcgtggctgctgttggaatcctcagggacccataagtgtgccctggtgc
tactattctcagagtcatggttatcaaatggaggacaaccttgtaaacacaaatgcagga
ttcacagcccagttgaaaaggttgccttctccatctctgtttggaaatgatgtcaacaat
gtccttctcacagcggaatgtcagacatctaatcgtttccactttaagttaactgaccaa
aaccaggacaggtacgaagtgccccatgaacacgtgcaatccttcaatggaaatgctgct
tctgccttgacctatgaagttacggtctcaaaacagccatttagcatcaaagtgaccaga
agaagcaacaatcgtgttctgtttgactcaagcattgggcccctcttgtttgctgatcag
ttcctgcagctctccatccgtctgccgagcgccatccgtctgccgagcgccaatgtgtat
gggctgggagaacatgtgcaccagcagtaccgtcatgatatgaattggaagacctggccc
atatttaatagggacacaacccccaatggggatggaactaacttgtatggtgcacagacg
ttcttcctgtgtcttgaagatgctagtggattgtcgtttggagtgtttctgttgaacagc
aatgccatggaggtttctctccagcctgccccggcggtcacttaccgcaccatcgggggt
attcttgatttctatgtgttcttgggaaacacgccagagcaagtcgttcaagagtatctg
gagctcattggacgaccagccctaccttcatactgggcacttggatttcatctcagtcgt
tatgattatgggagcctggacaacatgaaagaagtcgtggagagaaatcgtgcagcacaa
cttccttacgacgttcagcatgctgatattgattatatggatgagaggaaggatttcact
tataatccagtagattttaaagacttcccagagtttgctaaggagttacacaataatgga
cagaaactcatcatcattgtggatccagccatctccaacaactcttccccaagtcaaccc
tatggcccctatgacaggggttcagatatgaagatatgggtgaatgcttcaaatggagtg
actccactcattggggaggtctggcctggaaaaactgtgtttcctgattataccaaccct
cagtgtgctgtttggtgggcaagggaatttgagcttttccacaaccaagtggactttgat
ggaatctggattgatatgaatgaagtctccaatttcattgatggttccgtgtcaggatgc
agtgtgcatcttgagctctggttgactgacccttcttttgtcccaggagtccttgatggg
tacctgttctccaagactctctgcatggatgcagtgcagtactggggcaagcaatatgat
gtccacaatgtgtacggctactcgatggcgattgccacagcagaagcggtcaatactgtg
ttccctagtaagagaagctttattctaacccgttctacctttgcgggatctggcaagttt
gcagcccattggttaggagacaacacagccacctggaatgaccttcgatggtccatccct
ggcatccttgagttcaacctttttggtatccctatggtgggtcctgacatatgtggcttt
ttcttggattcctctgaagagctctgcaggcggtggatgcagctgggagcattttatcca
ttttccaggaatcacaatggccaaggctacaaggcccaggatcctgccttctttggagct
gactctctgctggtgaattcctccaggcactaccttaccatccgctatactctattgcca
tacctctacaccctcttctaccgagctcacagccggggggacacggtggccaggcccctt
ctgcatgagttctatggtgacagcagcacttgggatgtgcaccaacagtttttatggggg
cccggcctcctcatcactccagttctagaggagggtgcagagaaagtgatggcatatatg
cctgatgctgtctggtatgattatgagactgggggccgagtgagatggaggaagcaacaa
gtggagatggatcttcctggggacaaaattgggcttcatcttcgaggaggatatatcttc
cctacacaacagccagccacaaccactgtagccagtcgaaggaaccctcttggtcttatc
atttcgaaggaaccctcttggtcttatcattgcttaagaagtttcagatcttgcaagacc
tttgtcctaaggataaatttccttgtcccttccccattcctacaggttgcccttatcaca
gaacttgatcttatcctgggagaagcatacactgtggagtgggagttgaaggtagcggat
gaagaaaaaatagactgttatccagatgagaatggtgtttctgcagaaaattgcactgcc
cgtggctgtgtctgggaggaatccagttctcctggagtccctttttgctatttcgtcagt
gacttatactctgtcagtgatgttcagtatgacacccatggggccacagctgtcatctct
ttaaattcctctccttatgcctatgctttgccctcaatacccgtgaactccctccatctg
aatgtgacctaccataagaatgacatgctgcagtttaagatttatgatcccaacaacaac
cggtatgaagttccagtccctctcaacataccccaggttccatccagcacctctgagagt
cgactctatgatgtcctcattaagaagaatccatttgggattgaaattcgccgaaagagt
acaggcactgtaatttgggactctcagctccttggcttcaccttcaatgacatgttcatc
cgcatctccactcgccttccttcccggtacctctacggctttggggaaaatgagcacaca
gcctttcggagagacttaaactggcacacatgggggatgttttcccgagaccaaccccca
gggtacaagaagaattcctatggagtccacccctactacatggggctggaggaggatggc
agtgcccatggggtgctcctgctaaacagcaatgccatggatgtgacattccagcctttg
cctgccttgacataccgcaccacagggggaattctggacttttacgtgttcttggggcca
actccagagattgtcactcagcaatacactgagttgattggtcggccggtgatggttcct
tactggtccttggggtttcagctgtgtcgctatggatacgagaatgacactgagattgcc
aacttgtatgatgacatggtggctgcccagatcccctatgatgtacaatactcagacatc
gactacatggagcggcagatggacttcaccctcagccccaagtttgctggatttccagat
ctgattactcgcatgcatgctgatgggatgcgggtcatcctcattctggatccagccatt
tctggcaatgagacacagccctatcctgcattcacccggggtgtggaagatgacgtcttc
atcaaagctccaggtggtggaggcattgtctggggaaaggtctggcctgattttcctgat
gttgttgtaaatgattctttagactgggatactcaagtggagctataccgagcttataca
gccttcccagactttttccgtaattcaactgtcaaatggtggaagagggagtttgaagaa
ctatacagcaacccacagaatccagagaagagcttgaagtttgatggcatgtggattgac
atgaatgaaccggcaagctttgtgaatggggcagttcctccaggctgcatgaatgccact
ctgaaccaccctccctatatgccatatttggagtccagggacagcggtctgagcagcaag
accctttgcatggagagtgagcagatcctgccagatggctcccgggtgcggcactatgat
gtgcacagcctgtacgggtggtcccagaccagacccacatacgaagctgtgcaggaggtg
acaggacagcgagggattgtcatcactcgttccacattcccctcttctggccgctgggca
ggacactggttgggagacaacacggctgcatgggaccaactgaggaaatctatcattggc
atgatggagtttagcctctttggcatatcctatacaggagcagatatttgtgggttcttt
caagatgctgaatatgagatgtgtgctcgctggatgcaactgggggccttttacccattc
tcaaggaaccacaacaccattgggaccaggagacaagaccctgtgtcctgggatgctacc
tttgtgaatatctccaaaactgtcctgcagaccagatacactctgttgccgtatctctac
accctgatgcacttggcccacacggagggcagcactgttgtgcggcctcttctccatgag
tttgtgtcagaccaggtgacctgggatatagacagtcagttcctgctgggcccagccttc
ctggtcagccctgtcttggagcctaatgccagaaacgtcactgcatatttccccagagcc
cgctggtatgattactacacgggtgaggacattaaagcaaggggagagtggaagtccttg
ccagcccctcttgaccacatcaatcttcatgtccgagggggctacatcctgccctggcaa
gagcctgcacagaacacccacttaagccgtcagaaattcataggtttcaaggttgcattg
gatgacgatgggactgctgaaggttgtctcttctgggatgatgggcaaagcattgatacc
tatgaaaaaggactctattatctggccaacttttctgccagccagaatacgatgcagagt
catgtaattttcaaccaatacatcgttgacacaaaccctttgaaactgggctacattgag
atctggggagtgggcagtgctcctgtttccaatgtcagtgtctctctgagcagcacagtt
ataacacccgccttcacctacaaccctacaacacaggtgttaaacatcgatgtgaccagc
agagacatcagcctacataatttcatctcattgacatggagcagcactctgtga

DBGET integrated database retrieval system