KEGG   Equus przewalskii (Przewalski's horse): 103558454Help
Entry
103558454         CDS       T04644                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04068  FoxO signaling pathway
epz04146  Peroxisome
epz04211  Longevity regulating pathway
epz04213  Longevity regulating pathway - multiple species
epz05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103558454 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103558454 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway - mammal
    103558454 (SOD2)
   04213 Longevity regulating pathway - multiple species
    103558454 (SOD2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    103558454 (SOD2)
Enzymes [BR:epz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     103558454 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 103558454
NCBI-ProteinID: XP_008529694
LinkDB All DBs
Position
Un
AA seq 222 aa AA seqDB search
MLCRAACSTSRKLVPALGSLGSRQKHSLPDLQYDYGALEPYINAQIMQLHHSKHHAAYVN
NLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHTIFWTNLSPNGGGEPKGELLDA
IKRDFGSFDKFKEKLTAVSAGVQGSGWGWLGFNKDQGRLQIVACPNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVSERYMACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgccgggcggcgtgcagcacgagcaggaagctggtgccagctctggggtctctg
gggtcccggcagaagcacagcctccccgacttgcagtatgattatggcgctctggagccc
tacatcaacgcccagatcatgcagctgcaccacagcaagcaccacgcggcctatgtgaac
aacctgaacgtcaccgaggagaagtaccaggaggcgctggccaagggggacgtgacagct
cagattgctctgcagcctgcactcaagttcaatggtggaggccatatcaatcataccatt
ttctggacaaacctgagccccaatggcgggggagaacccaaaggggaattgctggacgcc
atcaaacgtgactttggttccttcgacaaatttaaagagaagttgactgctgtatcggct
ggtgtccaaggctcgggttggggttggcttggtttcaataaggaccagggacgcctccag
attgttgcctgtcctaaccaggatcccctgcagggaacaacaggtcttattcccctgctg
gggattgacgtgtgggagcacgcttattaccttcagtataaaaatgtcaggcctgattat
ctgaaagccatttggaatgtgatcaactgggagaatgtatctgagagatacatggcttgc
aaaaagtaa

DBGET integrated database retrieval system