KEGG   Equus przewalskii (Przewalski's horse): 103558835Help
Entry
103558835         CDS       T04644                                 

Gene name
GPD2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103558835 (GPD2)
Enzymes [BR:epz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     103558835 (GPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 FAD_binding_2 EF-hand_6 FAD_oxidored GIDA EF-hand_8 Pyr_redox_2 EF-hand_5 EF-hand_9 NAD_binding_8 HI0933_like EF-hand_10 Pyr_redox Pyr_redox_3 Thi4 FAD_binding_3 Dockerin_1 EF-hand_4 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 103558835
NCBI-ProteinID: XP_008530265
LinkDB All DBs
Position
Un
AA seq 770 aa AA seqDB search
MAFQKAVKGTILVGGGALASVLGLSQFAHYRRKQVNLAYVEAAECVSEPVNREPPSREAQ
LLTLQNTSEFDILVIGGGATGCGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMKLDIEQYRMVKEALHERANLLEIAPHLSAPLPIMLPIYKWWQLPYYWIGIKLY
DLVAGSNCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYMEVVSLLKKTDPQTGKERVSGARCKDVLTGQEFDVRAKCVINATGPFTDTVRKM
DDKNATAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDTPTD
VTPHPIPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNH
VVDISESGLITIAGGKWTTYRSMAEDTINAAIKTHDLKAGPSRTVGLFLQGGKDWSPTLY
IRLVQDYGLESEVAQHLAATYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEVKYG
IKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWDDYKKQEELETARKFLY
YEMGYKSRSEQLTDRSEISLRPSDVDRYKKRFHKFDADQKGFITIVDVQRVLESINVQMD
ENTLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPV
DRSCGGLELIMSENCLLTGRGCTEGFLQLLSSVVLVPCDLRQQQCQLWKW
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atggcatttcaaaaggcagtgaaagggactattcttgttggaggaggggctcttgcaagt
gttctaggcctctctcagtttgctcactacagaaggaagcaagtgaacctggcctatgtt
gaagcagcagagtgtgtctcagagcctgttaacagggagcctccttccagagaagctcag
ctgctgactttgcaaaatacatctgaattcgatatccttgtcattggaggaggagcaaca
ggatgtggctgtgcgctagatgctgtcaccagaggactaaaaacagcccttgtagaaaga
gatgatttctcatcggggaccagcagcagaagcactaaattgatccatggtggggtacga
tatcttcagaaggctatcatgaagttggatattgagcagtataggatggtaaaagaagcc
cttcacgagcgtgccaacctactagaaattgctccccatttatcagctccgttgcctata
atgcttccgatttacaagtggtggcagttaccttactactggattggaatcaagctatat
gatctggttgcaggaagcaattgcctgaaaagcagttatgtcctcagcaaatcgagagcc
cttgagcatttccctatgctccagaaggacaaactggtaggagcaattgtctactatgat
ggacaacacaacgacgcccggatgaaccttgccattgctcttactgctgccaggtatggg
gctgccacggccaattacatggaggtcgtgagcttgctcaagaagacagacccccaaacg
gggaaagagcgcgtgagcggtgcacggtgcaaggatgttctcacagggcaggaatttgat
gtgagagccaagtgtgttatcaatgccacgggacctttcacagacactgtgcgcaaaatg
gatgataagaacgccacagctatctgccagccaagtgccggtgtccacatcgtgatgccg
ggttattacagcccagagagcatgggacttcttgacccagcgaccagtgatgggcgagtt
attttcttcctaccctggcaaaagatgactatagctggcactaccgacactccaactgat
gttacaccccatcctattccttcggaagaagatattaacttcattttgaatgaagtgcgc
aactacctgagttgtgacgttgaagtgagaagaggggacgtcctggcggcatggagtggt
attcgtcctcttgttacagaccccaagtctgcggatactcagtccatctcccgaaatcat
gttgtggacatcagtgagagcggcctcatcactatagcaggtggaaagtggacaacctac
agatctatggcagaagataccataaatgctgctatcaagacccacgatttgaaagcagga
ccaagtagaacagttgggcttttccttcaagggggcaaagattggagccccacactctac
attcggcttgtccaggattacggactcgaaagtgaggtggcacagcatctggctgccacc
tatggtgacaaggcttttgaggtggccaaaatggcaagcgtgactggaaaaaggtggccc
attgttggagtgcgtctcgtgtcagaatttccatacattgaagcagaggtgaaatatggg
attaaggagtacgcctgcactgcagtggatatgatttcacgtcgcactcgcctggccttt
ctgaatgtccaggcagcagaggaagccctccccaggattgttgaactgatgggcagagaa
ctgaattgggatgattacaagaaacaggaagaacttgaaacagccaggaagtttctgtat
tatgaaatgggctataaatctcgatcagaacagttaacagatcgctctgaaattagccta
cggccttcagacgttgacaggtataagaagagatttcataagtttgatgcagaccaaaag
ggctttattaccattgttgatgttcaacgtgtattagagagtatcaatgttcaaatggat
gaaaatacactacatgaaattctgaatgaagtagatttgaacaaaaatggacaggttgaa
ctcaatgaatttttgcagctgatgagtgccattcaaaaaggaagagtgtccggaagccgg
cttgctatactaatgaaaactgcagaagagaacctggacaggagagttcccattccggtg
gaccgaagttgcggaggattagaattgatcatgagtgaaaattgtttgctcacaggaaga
ggatgcacagaggggttcttgcagcttctgtccagtgtggtgctggtgccttgtgacctg
aggcaacagcagtgccagctttggaagtggtga

DBGET integrated database retrieval system