KEGG   Equus przewalskii (Przewalski's horse): 103560327Help
Entry
103560327         CDS       T04644                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00020  Citrate cycle (TCA cycle)
epz00190  Oxidative phosphorylation
epz01100  Metabolic pathways
epz01200  Carbon metabolism
epz04714  Thermogenesis
epz04932  Non-alcoholic fatty liver disease (NAFLD)
epz05010  Alzheimer disease
epz05012  Parkinson disease
epz05016  Huntington disease
Module
epz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
epz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
epz_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103560327 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103560327 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    103560327 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    103560327 (SDHA)
   05012 Parkinson disease
    103560327 (SDHA)
   05016 Huntington disease
    103560327 (SDHA)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    103560327 (SDHA)
Enzymes [BR:epz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103560327 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 103560327
NCBI-ProteinID: XP_008532614
LinkDB All DBs
Position
Un
AA seq 659 aa AA seqDB search
TRPPFLQDTSRSPSVSQQWPATLQTRGFHFTVDGTKRASAKVSDSISTQYPVVDHEFDAV
VVGAGGAGLRAAFGLSEAGFDTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYD
TVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGRIYQRAFGGQSLKFGKGGQ
AHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIH
RIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTGIYGAGC
LITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKDHVY
LQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVLKHV
NGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCKPGDKVPPIK
PNAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQSHAAVFRVGSVLQEGCEKISQLYGD
LKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVRIDEYD
YSKPIQGQQKKPFEEHWRKHTLSYVDVKTGKVSLEYRPVIDRTLNEADCATVPPAIRSY
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
acacgtcccccattccttcaagacacttcacgctctccatctgtctctcagcagtggcca
gcaacgttgcagacccgtggttttcacttcactgttgatgggactaagagggcatctgct
aaagtttcagattcaatttctacacagtacccggtggtggatcatgaatttgatgcagtg
gtggtaggtgctggaggggccggcctgcgagctgcgtttggcctctctgaggcggggttt
gacacagcctgtgtgacaaagctctttcccaccaggtcacacactgtcgcagcccaggga
ggaatcaatgctgctctggggaacatggaagaggacaactggaggtggcacttctacgac
accgtgaagggctccgactggctgggggaccaggatgccatccactacatgacagagcag
gcccccgcctcggtggttgagctggagaattacggcatgccctttagcagaaccgaagat
gggaggatctaccagcgtgcctttggtggacagagcctcaagtttgggaaaggcgggcag
gcccatcggtgctgctgcgtggcagaccgcacaggccattccctgctgcacacgttgtat
ggaaggtctctacgatatgataccagctattttgtagagtattttgccttggatctcctg
atggaaaatggggagtgccgtggggttatcgcactatgcatagaagatgggtccatccat
cgcataagagcaaagaacactgttgtagctactggaggctatgggcgcacctacttcagc
tgcacgtctgcccacaccagcacaggcgacggcacggccatgatcaccagggcaggcctt
ccctgccaggacttggagttcgttcagttccaccctacaggcatatatggtgctggctgt
ctgatcacggaaggatgccgcggagagggtggcatcctcatcaacagtcagggcgaaagg
ttcatggagcggtacgcccccgtcgcaaaggacctggcatccagagatgttgtgtctcgg
tccatgactctggaaatccgggagggcagaggctgtggccctgagaaggatcatgtctac
ctgcagttgcaccaccttcccccccagcagctggccacacgcctaccaggcatttcagag
acggccatgatcttcgcgggtgtggatgtcaccaaggagcccatccctgtccttcccacc
gtgcattataacatgggtggcattcccaccaactacaaggggcaggttctgaagcatgtg
aacggccaggatcaggtcgtgcctggcctgtacgcttgtggggaggccgcctgtgcctca
gtgcatggcgccaaccgtcttggggcaaactcgctcttggacctggttgtctttggccgg
gcgtgtgccctgagtattgcagagtcctgcaaacctggagataaagttccccctattaaa
ccaaatgctggggaagaatctgtcatgaatcttgacaaactgaggtttgctgatggcagt
ataagaacgtcggaactgcgactcagcatgcagaagtcgatgcaaagtcatgctgcagtg
ttccgtgtgggaagcgtgttacaggaaggctgtgagaaaattagccagctctacggagac
cttaagcatctgaagacgtttgacagaggaatggtctggaatactgacctggtggagacc
ctggagctgcagaacctgatgctttgcgcgcttcagacgatttatggagcagaggcccgg
aaggagtcacgtggtgctcacgccagggaagattacaaggtgcggattgatgagtatgat
tactccaagcccatccaggggcagcagaagaagccatttgaggagcactggaggaagcat
actctttcctatgtcgatgtcaagaccgggaaggtctcgctggaatacagacccgtaatc
gacaggactttaaacgaggctgactgcgccacagtgcccccggccattcgctcctactga

DBGET integrated database retrieval system