KEGG   Equus przewalskii (Przewalski's horse): 103560690Help
Entry
103560690         CDS       T04644                                 

Gene name
HTR1F
Definition
(RefSeq) 5-hydroxytryptamine receptor 1F
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04024  cAMP signaling pathway
epz04080  Neuroactive ligand-receptor interaction
epz04726  Serotonergic synapse
epz04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    103560690 (HTR1F)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103560690 (HTR1F)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    103560690 (HTR1F)
  09157 Sensory system
   04742 Taste transduction
    103560690 (HTR1F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:epz04030]
    103560690 (HTR1F)
G protein-coupled receptors [BR:epz04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    103560690 (HTR1F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx DUF2208 Glycoprotein_G
Motif
Other DBs
NCBI-GeneID: 103560690
NCBI-ProteinID: XP_008533148
LinkDB All DBs
Position
Un
AA seq 366 aa AA seqDB search
MDFLNSSDQNLTTEEMLYRMPSKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANY
LICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALD
RYRAITDAVEYARKRTPKHAGIMITVVWIISIFISMPPLFWRHQGTSREDECIIKHDHIV
STIYSTFGAFYIPLTLILILYYKIYKAAKTLYHKRQASRIAKEELNGQVLLESGEKSTRL
VSTPYTLEKSLSDPSTDLDKIHSTVKSPKSEFKHDKSWRRQKISGTRERKAATTLGLILG
AFVICWLPFFVKELVVNVCEKCKISEEMSNFLTWLGYLNSLINPLIYTAFNEDFKKAFQK
LAQCRC
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggatttcttaaactcatctgatcaaaacttgaccacagaagaaatgttatacagaatg
ccatccaaaatcctggtgtccctcactctctctggtctggcactgatgacaacgaccatc
aactctcttgtgatagctgcaattattgtgacccggaagctgcaccacccagccaactat
ttaatctgttcccttgcagtcacagattttcttgtagctgtcctggtgatgcctttcagc
attgtgtacattgtgagagagagctggattatggggcaagtggtctgtgacatttggctg
agtgttgacattacgtgctgcacatgctccatcttgcatctctctgctatagctctggat
cggtaccgggcaatcacagatgctgttgagtatgccaggaaaaggactcccaagcatgct
ggcattatgattactgttgtttggattatatctatttttatctctatgcctcctctattc
tggaggcaccaaggaactagccgagaagatgaatgcatcatcaaacacgaccacattgtt
tccactatttactcaacatttggagctttctacattccattaacattgattttgatcctc
tactacaaaatatataaagcagcaaagacgttataccacaagagacaagcaagtaggatt
gccaaggaggagctgaatggccaggtccttttggagagtggtgagaaaagcacgaggctg
gtctccacaccatatacactagaaaagtctctatctgatccatcaacagaccttgataaa
attcatagcacagtgaagagtcccaagtctgaattcaagcatgacaaatcttggagaagg
caaaagatctcaggcacaagagagcgcaaagcagccactaccctggggttgatcttgggt
gcatttgtaatatgttggctccctttttttgtaaaagaattggttgttaatgtgtgtgaa
aagtgtaaaatttctgaggaaatgtccaattttttgacatggcttggatatctcaattcc
cttataaatccactgatttatacagcctttaatgaagacttcaagaaagcattccaaaaa
cttgcgcaatgtcgatgttaa

DBGET integrated database retrieval system